KEGG   Homo sapiens (human): 2934Help
Entry
2934              CDS       T01001                                 

Gene name
GSN, ADF, AGEL
Definition
gelsolin
Orthology
K05768  
gelsolin
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Viral carcinogenesis
Disease
H00845  
Familial amyloidosis
H00956  
Lattice corneal dystrophies (LCD)
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33
AA seq 782 aa AA seqDB search
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcaccgccccgcgcccgcgctgctttgcgcgctgtccctggcgctgtgcgcg
ctgtcgctgcccgtccgcgcggccactgcgtcgcggggggcgtcccaggcgggggcgccc
caggggcgggtgcccgaggcgcggcccaacagcatggtggtggaacaccccgagttcctc
aaggcagggaaggagcctggcctgcagatctggcgtgtggagaagttcgatctggtgccc
gtgcccaccaacctttatggagacttcttcacgggcgacgcctacgtcatcctgaagaca
gtgcagctgaggaacggaaatctgcagtatgacctccactactggctgggcaatgagtgc
agccaggatgagagcggggcggccgccatctttaccgtgcagctggatgactacctgaac
ggccgggccgtgcagcaccgtgaggtccagggcttcgagtcggccaccttcctaggctac
ttcaagtctggcctgaagtacaagaaaggaggtgtggcatcaggattcaagcacgtggta
cccaacgaggtggtggtgcagagactcttccaggtcaaagggcggcgtgtggtccgtgcc
accgaggtacctgtgtcctgggagagcttcaacaatggcgactgcttcatcctggacctg
ggcaacaacatccaccagtggtgtggttccaacagcaatcggtatgaaagactgaaggcc
acacaggtgtccaagggcatccgggacaacgagcggagtggccgggcccgagtgcacgtg
tctgaggagggcactgagcccgaggcgatgctccaggtgctgggccccaagccggctctg
cctgcaggtaccgaggacaccgccaaggaggatgcggccaaccgcaagctggccaagctc
tacaaggtctccaatggtgcagggaccatgtccgtctccctcgtggctgatgagaacccc
ttcgcccagggggccctgaagtcagaggactgcttcatcctggaccacggcaaagatggg
aaaatctttgtctggaaaggcaagcaggcaaacacggaggagaggaaggctgccctcaaa
acagcctctgacttcatcaccaagatggactaccccaagcagactcaggtctcggtcctt
cctgagggcggtgagaccccactgttcaagcagttcttcaagaactggcgggacccagac
cagacagatggcctgggcttgtcctacctttccagccatatcgccaacgtggagcgggtg
cccttcgacgccgccaccctgcacacctccactgccatggccgcccagcacggcatggat
gacgatggcacaggccagaaacagatctggagaatcgaaggttccaacaaggtgcccgtg
gaccctgccacatatggacagttctatggaggcgacagctacatcattctgtacaactac
cgccatggtggccgccaggggcagataatctataactggcagggtgcccagtctacccag
gatgaggtcgctgcatctgccatcctgactgctcagctggatgaggagctgggaggtacc
cctgtccagagccgtgtggtccaaggcaaggagcccgcccacctcatgagcctgtttggt
gggaagcccatgatcatctacaagggcggcacctcccgcgagggcgggcagacagcccct
gccagcacccgcctcttccaggtccgcgccaacagcgctggagccacccgggctgttgag
gtattgcctaaggctggtgcactgaactccaacgatgcctttgttctgaaaaccccctca
gccgcctacctgtgggtgggtacaggagccagcgaggcagagaagacgggggcccaggag
ctgctcagggtgctgcgggcccaacctgtgcaggtggcagaaggcagcgagccagatggc
ttctgggaggccctgggcgggaaggctgcctaccgcacatccccacggctgaaggacaag
aagatggatgcccatcctcctcgcctctttgcctgctccaacaagattggacgttttgtg
atcgaagaggttcctggtgagctcatgcaggaagacctggcaacggatgacgtcatgctt
ctggacacctgggaccaggtctttgtctgggttggaaaggattctcaagaagaagaaaag
acagaagccttgacttctgctaagcggtacatcgagacggacccagccaatcgggatcgg
cggacgcccatcaccgtggtgaagcaaggctttgagcctccctcctttgtgggctggttc
cttggctgggatgatgattactggtctgtggaccccttggacagggccatggctgagctg
gctgcctga

DBGET integrated database retrieval system