KEGG   Homo sapiens (human): 2937Help
Entry
2937              CDS       T01001                                 

Gene name
GSS, GSHS, HEL-S-64p, HEL-S-88n
Definition
(RefSeq) glutathione synthetase
  KO
K21456  
glutathione synthase [EC:6.3.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Ferroptosis
Module
Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  
Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2937 (GSS)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2937 (GSS)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    2937 (GSS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     2937 (GSS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2937 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P48637(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 474 aa AA seqDB search
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSA
LLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVF
LGLNRSDYMFQRSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKIL
SNNPSKGLALGIAKAWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFE
DISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ
LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSR
FVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaactgggggagcctcttgcaggataaacagcagctagaggagctggcacgg
caggccgtggaccgggccctggctgagggagtattgctgaggacctcacaggagcccact
tcctcggaggtggtgagctatgccccattcacgctcttcccctcactggtccccagtgcc
ctgctggagcaagcctatgctgtgcagatggacttcaacctgctagtggatgctgtcagc
cagaacgctgccttcctggagcaaactctttccagcaccatcaaacaggatgactttacc
gctcgtctctttgacatccacaagcaagtcctaaaagagggcattgcccagactgtgttc
ctgggcctgaatcgctcagactacatgttccagcgcagcgcagatggctccccagccctg
aaacagatcgaaatcaacaccatctctgccagctttgggggcctggcctcccggacccca
gctgtgcaccgacatgttctcagtgtcctgagtaagaccaaagaagctggcaagatcctc
tctaataatcccagcaagggactggccctgggaattgccaaagcctgggagctctacggc
tcacccaatgctctggtgctactgattgctcaagagaaggaaagaaacatatttgaccag
cgtgccatagagaatgagctactggccaggaacatccatgtgatccgacgaacatttgaa
gatatctctgaaaaggggtctctggaccaagaccgaaggctgtttgtggatggccaggaa
attgctgtggtttacttccgggatggctacatgcctcgtcagtacagtctacagaattgg
gaagcacgtctactgctggagaggtcacatgctgccaagtgcccagacattgccacccag
ctggctgggactaagaaggtgcagcaggagctaagcaggccgggcatgctggagatgttg
ctccctggccagcctgaggctgtggcccgcctccgcgccacctttgctggcctctactca
ctggatgtgggtgaagaaggggaccaggccatcgccgaggcccttgctgcccctagccgg
tttgtgctaaagccccagagagagggtggaggtaacaacctatatggggaggaaatggta
caggccctgaaacagctgaaggacagtgaggagagggcctcctacatcctcatggagaag
atcgaacctgagccttttgagaattgcctgctacggcctggcagccctgcccgagtggtc
cagtgcatttcagagctgggcatctttggggtctatgtcaggcaggaaaagacactcgtg
atgaacaagcacgtggggcatctacttcgaaccaaagccatcgagcatgcagatggtggt
gtggcagcgggagtggcagtcctggacaacccataccctgtgtga

DBGET integrated database retrieval system