KEGG   Homo sapiens (human): 2937Help
Entry
2937              CDS       T01001                                 

Gene name
GSS, GSHS, HEL-S-64p, HEL-S-88n
Definition
(RefSeq) glutathione synthetase
  KO
K01920  
glutathione synthase [EC:6.3.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  
Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2937 (GSS)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2937 (GSS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     2937 (GSS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2937 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P48637(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 474 aa AA seqDB search
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSA
LLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVF
LGLNRSDYMFQRSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKIL
SNNPSKGLALGIAKAWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFE
DISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ
LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSR
FVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaactgggggagcctcttgcaggataaacagcagctagaggagctggcacgg
caggccgtggaccgggccctggctgagggagtattgctgaggacctcacaggagcccact
tcctcggaggtggtgagctatgccccattcacgctcttcccctcactggtccccagtgcc
ctgctggagcaagcctatgctgtgcagatggacttcaacctgctagtggatgctgtcagc
cagaacgctgccttcctggagcaaactctttccagcaccatcaaacaggatgactttacc
gctcgtctctttgacatccacaagcaagtcctaaaagagggcattgcccagactgtgttc
ctgggcctgaatcgctcagactacatgttccagcgcagcgcagatggctccccagccctg
aaacagatcgaaatcaacaccatctctgccagctttgggggcctggcctcccggacccca
gctgtgcaccgacatgttctcagtgtcctgagtaagaccaaagaagctggcaagatcctc
tctaataatcccagcaagggactggccctgggaattgccaaagcctgggagctctacggc
tcacccaatgctctggtgctactgattgctcaagagaaggaaagaaacatatttgaccag
cgtgccatagagaatgagctactggccaggaacatccatgtgatccgacgaacatttgaa
gatatctctgaaaaggggtctctggaccaagaccgaaggctgtttgtggatggccaggaa
attgctgtggtttacttccgggatggctacatgcctcgtcagtacagtctacagaattgg
gaagcacgtctactgctggagaggtcacatgctgccaagtgcccagacattgccacccag
ctggctgggactaagaaggtgcagcaggagctaagcaggccgggcatgctggagatgttg
ctccctggccagcctgaggctgtggcccgcctccgcgccacctttgctggcctctactca
ctggatgtgggtgaagaaggggaccaggccatcgccgaggcccttgctgcccctagccgg
tttgtgctaaagccccagagagagggtggaggtaacaacctatatggggaggaaatggta
caggccctgaaacagctgaaggacagtgaggagagggcctcctacatcctcatggagaag
atcgaacctgagccttttgagaattgcctgctacggcctggcagccctgcccgagtggtc
cagtgcatttcagagctgggcatctttggggtctatgtcaggcaggaaaagacactcgtg
atgaacaagcacgtggggcatctacttcgaaccaaagccatcgagcatgcagatggtggt
gtggcagcgggagtggcagtcctggacaacccataccctgtgtga

DBGET integrated database retrieval system