KEGG   Homo sapiens (human): 29789Help
Entry
29789             CDS       T01001                                 

Gene name
OLA1, DOC45, GBP45, GTBP9, GTPBP9, PTD004
Definition
(RefSeq) Obg-like ATPase 1
  KO
K19788  
obg-like ATPase 1
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     29789 (OLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.1
AA seq 396 aa AA seqDB search
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccccctaaaaagggaggtgatggaattaaaccacccccaatcattggaagatttgga
acctcactgaaaattggtattgttggattgccaaatgttgggaaatctactttcttcaat
gtgttaaccaatagtcaggcttcagcagaaaacttcccgttctgcactattgatcctaat
gagagcagagtacctgtgccagatgaaaggtttgactttctttgtcaataccacaaacca
gcaagcaaaattcctgcctttctaaatgtggtggatattgctggccttgtgaaaggagct
cacaatgggcagggcctggggaatgcttttttatctcatattagtgcctgtgatggcatc
tttcatctaacacgtgcttttgaagatgatgatatcacgcacgttgaaggaagtgtagat
cctattcgagatatagaaataatacatgaagagcttcagcttaaagatgaggaaatgatt
gggcccattatagataaactagaaaaggtggctgtgagaggaggagataaaaaactaaaa
cctgaatatgatataatgtgcaaagtaaaatcctgggttatagatcaaaagaaacctgtt
cgcttctatcatgattggaatgacaaagagattgaagtgttgaataaacacttatttttg
acttcaaaaccaatggtctacttggttaatctttctgaaaaagactacattagaaagaaa
aacaaatggttgataaaaattaaagagtgggtggacaagtatgacccaggtgctttggtc
attccttttagtggggccttggaactcaagttgcaagaattgagtgctgaggagagacag
aagtatctggaagcgaacatgacacaaagtgctttgccaaagatcattaaggctgggttt
gcagcactccaactagaatactttttcactgcaggcccagatgaagtgcgtgcatggacc
atcaggaaagggactaaggctcctcaggctgcaggaaagattcacacagattttgaaaag
ggattcattatggctgaagtaatgaaatacgaagattttaaagaggaaggttctgaaaat
gcagtcaaggctgctggaaagtacagacaacaaggcagaaattatattgttgaagatgga
gatattatcttcttcaaatttaacacacctcaacaaccgaagaagaaataa

DBGET integrated database retrieval system