KEGG   Homo sapiens (human): 2986Help
Entry
2986              CDS       T01001                                 

Gene name
GUCY2F, CYGF, GC-F, GUC2DL, GUC2F, RETGC-2, ROS-GC2
Definition
(RefSeq) guanylate cyclase 2F, retinal (EC:4.6.1.2)
  KO
K12322  
guanylate cyclase 2F [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    2986 (GUCY2F)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2986 (GUCY2F)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2986 (GUCY2F)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: RGC group
  RGC family [OT]
   2986 (GUCY2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 1108 aa AA seqDB search
MFLGLGRFSRLVLWFAAFRKLLGHHGLASAKFLWCLCLLSVMSLPQQVWTLPYKIGVVGP
WACDSLFSKALPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQAD
RIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRN
NPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIA
QAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
TYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKICHGGIDPAFAMMVCLTLLIAL
LSINGFAYFIRRRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRASVSFQITSEVQS
GRSPRLSFSSGSLTPATYENSNIAIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKD
LRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSMEELLWTAPELLRA
PRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFMKPLPVPPPVDKDG
QVGHGLQPVEIAAFQRRKAERQLVRNKP
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggactcgggcgcttttctcgccttgttctctggtttgcggctttcaggaaa
ctgctgggacaccatggccttgcatctgccaagttcctgtggtgcttgtgccttctgtct
gtcatgtcccttccgcagcaggtgtggacactcccctacaagataggggtggtgggccct
tgggcttgtgattcgctgttttcaaaggccctgcctgaggttgctgcgcgattagccatt
gagcgaatcaaccgggacccatcttttgacctgagttattcttttgaatacgtgattctc
aatgaagactgccagacttcgagggctctctccagtttcatttcccaccaccagatggcc
tcaggatttattggacctaccaaccctggctactgcgaggcagcctcgctcctgggaaac
agctgggacaaaggaattttctcttgggcttgtgtgaattatgaattagacaataaaatt
agctacccgaccttttctcggacactcccttctcccatccgggtgcttgtaactgtcatg
aaatatttccagtgggctcatgctggagtcatttcctcagatgaagacatttgggtgcat
acagccaatcgagtcgcaagtgctcttcggagccacggcttacctgtaggggtcgtcctg
accacaggacaagacagccaaagcatgcggaaagccctccagaggattcaccaggcagac
agaattcgcataatcatcatgtgtatgcattcagctttgattgggggagagactcagatg
catctcttggaatgtgctcatgatctgaaaatgactgatggaacctacgtctttgttcct
tatgatgccctgctctacagtttaccttataagcacaccccctaccgggtcctaaggaac
aacccaaagctccgggaagcctatgatgcagtgttgaccattacagtggagtcccaagaa
aagaccttctatcaagccttcacagaggcagcagcaagaggtgaaattcctgagaagctg
gagttcgatcaagtttcaccgttgtttggaaccatctacaattcaatttactttatcgca
caagccatgaataatgctatgaaagaaaatggacaggctggtgctgccagcctggttcag
cattccagaaacatgcagttccatggattcaaccagttgatgaggacagattcaaatgga
aatggaatttcagaatatgtaatcctggacaccaacttgaaagaatgggaactccatagc
acctacactgtggacatggaaatggagctgctacgtttcggagggacccctattcacttc
cctggtggcaggccccctagagcagatgcaaaatgctggtttgcagaagggaagatctgc
catggaggcatcgaccctgcctttgccatgatggtctgccttactttgcttatagccctg
ctgtctattaatggatttgcttactttataaggcgtcgtataaataaaatccagttgatc
aaaggacccaatagaattctactgactttggaggatgtaacgtttatcaatccccacttt
ggcagtaagagaggaagtcgtgccagtgtaagcttccagattacctcagaggtccaaagt
gggaggtccccaagactctccttttcttcagggagtctaactccagctacctatgaaaac
tccaacatagcgatttatgagggtgattgggtgtggctgaaaaagttctcccttggagat
tttggagaccttaagtccatcaaatcaagagcaagtgatgtgttcgaaatgatgaaggac
ttgcgtcatgagaatattaaccctttattgggtttcttctatgattcggggatgtttgcc
attgtgacagaattctgttcccgagggagcctagaagacatactgacaaatcaagatgtg
aaacttgactggatgtttaaatcatcactcttgctggatctcataaagggcatgaagtac
ttacaccacagagagtttgttcatgggaggctaaagtctcgaaactgtgtggtagatggg
cgttttgtactaaaagtgacagattatggctttaacgacatcttagaaatgctgagactc
tctgaagaggaatcttctatggaagagctgctgtggacggcccctgaactgttgagagct
ccaagaggcagcaggttaggttcttttgcaggagatgtctatagctttgccatcatcatg
caagaagtgatggtccggggtaccccattctgcatgatggatctgccagctcaagaaatc
ataaacagacttaagaagcctcctcctgtgtacagaccagtagttcctcctgagcatgcc
cctccagaatgtctccagctgatgaagcagtgctgggctgaggctgcagaacaacgacca
acttttgatgaaatatttaaccagtttaaaacttttaataaagggaagaagaccaatatt
attgattctatgcttcggatgttggagcaatattctagcaacttggaagatttgattcgg
gagcggactgaagagctggaaattgaaaaacagaaaacggaaaagcttctaacacagatg
ctaccaccatcagttgctgaatctctcaaaaagggctgcacagttgaacctgagggcttt
gacttggtcaccttgtacttcagcgacattgtgggcttcacaaccatttcagccatgagt
gagcccattgaggtcgtggatcttctgaatgacctgtacacactctttgatgcaataatt
ggcagtcatgatgtctacaaggtagagaccattggagatgcctacatggtggcttcaggc
ctcccaaagaggaatggcagtaggcatgcagctgagattgcaaacatgtccttagatatc
ctgagctctgtgggcactttcaagatgcggcacatgccagaagtgccggtccgaattcga
attggccttcactcagggccggttgttgctggagtggtgggcctcaccatgcccagatac
tgcttgtttggagacactgtgaacacagcttctcggatggaatctacaggcttaccttat
cgcattcatgtcagtctcagcactgttacaattcttcaaaatctgagtgagggctatgaa
gtggagcttcgaggaagaacagagctcaagggcaaaggcacagaggaaaccttctggctg
attgggaaaaaaggcttcatgaagccccttcctgtgcccccaccagtggacaaagatggg
caagtgggccatggcctgcaaccagtggagattgcagccttccaaagaagaaaagcagaa
aggcagttggtgagaaacaagccataa

DBGET integrated database retrieval system