KEGG   Homo sapiens (human): 29949Help
Entry
29949             CDS       T01001                                 

Gene name
IL19, IL-10C, MDA1, NG.1, ZMDA1
Definition
interleukin 19
Orthology
K05444  
interleukin 19/20/24
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    29949 (IL19)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29949 (IL19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.2
AA seq 177 aa AA seqDB search
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacagtgtgtttccctttggctcctgggtacaatactgatattgtgctcagta
gacaaccacggtctcaggagatgtctgatttccacagacatgcaccatatagaagagagt
ttccaagaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctg
tccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgccaccagagtcatc
catgacaactatgatcagctggaggtccacgctgctgccattaaatccctgggagagctc
gacgtctttctagcctggattaataagaatcatgaagtaatgttctcagcttga

DBGET integrated database retrieval system