KEGG   Homo sapiens (human): 3014Help
Entry
3014              CDS       T01001                                 

Gene name
H2AFX, H2A.X, H2A/X, H2AX
Definition
H2A histone family, member X
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    3014 (H2AFX)
  Substance dependence
   05034 Alcoholism
    3014 (H2AFX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3014 (H2AFX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.3
AA seq 143 aa AA seqDB search
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccgcggcaagactggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg
cgcgccggcctccagttcccagtgggccgtgtacaccggctgctgcggaagggccactac
gccgagcgcgttggcgccggcgcgccagtgtacctggcggcagtgctggagtacctcacc
gctgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacgcgaatcatc
ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc
gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accagcgccaccgtggggccgaaggcgccctcgggcggcaagaaggccacccaggcctcc
caggagtactaa

DBGET integrated database retrieval system