KEGG   Homo sapiens (human): 3015Help
Entry
3015              CDS       T01001                                 

Gene name
H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ
Definition
H2A histone family, member Z
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 128 aa AA seqDB search
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system