KEGG   Homo sapiens (human): 3015Help
Entry
3015              CDS       T01001                                 

Gene name
H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ
Definition
H2A histone family, member Z
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    3015 (H2AFZ)
  Substance dependence
   05034 Alcoholism
    3015 (H2AFZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3015 (H2AFZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 128 aa AA seqDB search
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system