KEGG   Homo sapiens (human): 3021Help
Entry
3021              CDS       T01001                                 

Gene name
H3F3B, H3.3B
Definition
H3 histone, family 3B (H3.3B)
Orthology
K11253  
histone H3
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaagtccaccggtgggaaagccccccgcaaacag
ctggccacgaaagccgccaggaaaagcgctccctctaccggcggggtgaagaagcctcat
cgctacaggcccgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgag
ctgctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaaa
accgacctgaggtttcagagcgcagccatcggtgcgctgcaggaggctagcgaagcgtac
ctggtgggtctgttcgaagataccaacctgtgtgccatccacgctaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system