KEGG   Homo sapiens (human): 3062Help
Entry
3062              CDS       T01001                                 

Gene name
HCRTR2, OX2R
Definition
hypocretin (orexin) receptor 2
Orthology
K04239  
hypocretin (orexin) receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3062 (HCRTR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Orexin
    3062 (HCRTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12
AA seq 444 aa AA seqDB search
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccaaattggaggactcccccccttgtcgcaactggtcatctgcttcggag
ctgaatgaaactcaagagccctttttaaaccccaccgactatgacgacgaggaattcctg
cggtacctgtggagggaatacctgcacccgaaagaatatgagtgggtcctgatcgccggg
tacatcatcgtgttcgtcgtggctctcattgggaacgtcctggtttgtgtggcagtgtgg
aagaaccaccacatgaggacggtaaccaactacttcatagtcaatctttctctggctgat
gtgctcgtgaccatcacctgccttccagccacactggtcgtggatatcactgagacctgg
ttttttggacagtccctttgcaaagtgattccttatctacagaccgtgtcggtgtctgtg
tctgtcctcacactgagctgtatcgccttggatcggtggtatgcaatctgtcaccctttg
atgtttaagagcacagcaaagcgggcccgtaacagcattgtcatcatctggattgtctcc
tgcattataatgattcctcaggccatcgtcatggagtgcagcaccgtgttcccaggctta
gccaataaaaccaccctctttacggtgtgtgatgagcgctggggtggtgaaatttatccc
aagatgtaccacatctgtttctttctggtgacatacatggcaccactgtgtctcatggtg
ttggcttatctgcaaatatttcgcaaactctggtgtcgacagatccctggaacatcatct
gtagttcagagaaaatggaagcccctgcagcctgtttcacagcctcgagggccaggacag
ccaacgaagtcccggatgagcgctgtggcggctgaaataaagcagatccgagccagaagg
aaaacagcccggatgttgatgattgtgcttttggtatttgcaatttgctatctaccaatt
agcatcctcaatgtgctaaagagagtatttgggatgtttgcccatactgaagacagagag
actgtgtatgcctggtttaccttttcacactggcttgtatatgccaatagtgctgcgaat
ccaattatttataattttctcagtggaaaatttcgagaggaatttaaagctgcgttttct
tgctgttgccttggagttcaccatcgccaggaggatcggctcaccaggggacgaactagc
acagagagccggaagtccttgaccactcaaatcagcaactttgataacatatcaaaactt
tctgagcaagttgtgctcactagcataagcacactcccagcagccaatggagcaggacca
cttcaaaactggtag

DBGET integrated database retrieval system