KEGG   Homo sapiens (human): 3082Help
Entry
3082              CDS       T01001                                 

Gene name
HGF, DFNB39, F-TCF, HGFB, HPTA, SF
Definition
hepatocyte growth factor (hepapoietin A; scatter factor)
Orthology
K05460  
hepatocyte growth factor
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Malaria
Pathways in cancer
Proteoglycans in cancer
Renal cell carcinoma
Melanoma
Disease
H00605  
Deafness, autosomal recessive
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.1
AA seq 728 aa AA seqDB search
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacaaaggaaaagaagaaatacaattcat
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataaaggactt
ccattcacttgcaaggcttttgtttttgataaagcaagaaaacaatgcctctggttcccc
ttcaatagcatgtcaagtggagtgaaaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactatgaatgacactgatgttcctttg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaactgtgatatgtcacatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacatcgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcccgtaatatcttgtgccaaaacgaaacaattgcgagttgtaaatgggattcca
acacgaacaaacataggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggagagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccacggaagaggagatgagaaa
tgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtt
ttaatgaagcttgccaggcctgctgtcctggatgattttgttagtacgattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggcctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcatcgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgaaaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system