KEGG   Homo sapiens (human): 3082Help
Entry
3082              CDS       T01001                                 

Gene name
HGF, DFNB39, F-TCF, HGFB, HPTA, SF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05144  Malaria
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05218  Melanoma
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00043  HGF-MET-PI3K signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00247  HGF-overexpression to PI3K signaling pathway
Disease
H00048  Hepatocellular carcinoma
H00605  Deafness, autosomal recessive
Drug target
Ficlatuzumab: D10123
Rilotumumab: D09659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3082 (HGF)
   04015 Rap1 signaling pathway
    3082 (HGF)
   04010 MAPK signaling pathway
    3082 (HGF)
   04151 PI3K-Akt signaling pathway
    3082 (HGF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3082 (HGF)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    3082 (HGF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3082 (HGF)
   05205 Proteoglycans in cancer
    3082 (HGF)
   05225 Hepatocellular carcinoma
    3082 (HGF)
   05226 Gastric cancer
    3082 (HGF)
   05218 Melanoma
    3082 (HGF)
   05211 Renal cell carcinoma
    3082 (HGF)
  Infectious diseases
   05144 Malaria
    3082 (HGF)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3082 (HGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3082 (HGF)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   3082 (HGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Motif
Other DBs
NCBI-GeneID: 3082
NCBI-ProteinID: NP_000592
OMIM: 142409
HGNC: 4893
Ensembl: ENSG00000019991
Vega: OTTHUMG00000023804
Pharos: P14210(Tchem)
UniProt: P14210
Structure
PDB: 

Jmol
Position
7q21.11
AA seq 728 aa AA seqDB search
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacaaaggaaaagaagaaatacaattcat
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataaaggactt
ccattcacttgcaaggcttttgtttttgataaagcaagaaaacaatgcctctggttcccc
ttcaatagcatgtcaagtggagtgaaaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactatgaatgacactgatgttcctttg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaactgtgatatgtcacatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacatcgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcccgtaatatcttgtgccaaaacgaaacaattgcgagttgtaaatgggattcca
acacgaacaaacataggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggagagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccacggaagaggagatgagaaa
tgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtt
ttaatgaagcttgccaggcctgctgtcctggatgattttgttagtacgattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggcctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcatcgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgaaaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system