KEGG   Homo sapiens (human): 3082Help
Entry
3082              CDS       T01001                                 

Gene name
HGF, DFNB39, F-TCF, HGFB, HPTA, SF
Definition
hepatocyte growth factor (hepapoietin A; scatter factor)
Orthology
K05460  
hepatocyte growth factor
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Malaria
Pathways in cancer
Proteoglycans in cancer
Renal cell carcinoma
Melanoma
Disease
H00605  
Deafness, autosomal recessive
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3082 (HGF)
   04015 Rap1 signaling pathway
    3082 (HGF)
   04151 PI3K-Akt signaling pathway
    3082 (HGF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3082 (HGF)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    3082 (HGF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3082 (HGF)
   05205 Proteoglycans in cancer
    3082 (HGF)
   05218 Melanoma
    3082 (HGF)
   05211 Renal cell carcinoma
    3082 (HGF)
  Infectious diseases
   05144 Malaria
    3082 (HGF)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  3082 (HGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.1
AA seq 728 aa AA seqDB search
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacaaaggaaaagaagaaatacaattcat
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataaaggactt
ccattcacttgcaaggcttttgtttttgataaagcaagaaaacaatgcctctggttcccc
ttcaatagcatgtcaagtggagtgaaaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactatgaatgacactgatgttcctttg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaactgtgatatgtcacatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacatcgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcccgtaatatcttgtgccaaaacgaaacaattgcgagttgtaaatgggattcca
acacgaacaaacataggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggagagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccacggaagaggagatgagaaa
tgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtt
ttaatgaagcttgccaggcctgctgtcctggatgattttgttagtacgattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggcctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcatcgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgaaaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system