KEGG   Homo sapiens (human): 30835Help
Entry
30835             CDS       T01001                                 

Gene name
CD209, CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1
Definition
CD209 molecule
Orthology
K06563  
CD209 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Tuberculosis
Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    30835 (CD209)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    30835 (CD209)
   05162 Measles
    30835 (CD209)
Cellular antigens [BR:hsa04090]
 Proteins
  30835 (CD209)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    30835 (CD209)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13
AA seq 268 aa AA seqDB search
MSDSKEPRLQQLGLLVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQEL
TQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVERLCHPC
PWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM
GLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWI
CKKSAASCSRDEEQFLSPAPATPNPPPA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagactgcagcagctgggcctcctggtgtccaaggtcccc
agctccataagtcaggaacaatccaggcaagacgcgatctaccagaacctgacccagctt
aaagctgcagtgggtgagctctcagagaaatccaagctgcaggagatctaccaggagctg
acccagctgaaggctgcagtgggtgagcttccagagaaatctaagctgcaggagatctac
caggagctgacccggctgaaggctgcagtgggtgagcttccagagaaatctaagctgcag
gagatctaccaggagctgacctggctgaaggctgcagtggaacgcctgtgccacccctgt
ccctgggaatggacattcttccaaggaaactgttacttcatgtctaactcccagcggaac
tggcacgactccatcaccgcctgcaaagaagtgggggcccagctcgtcgtaatcaaaagt
gctgaggagcagaacttcctacagctgcagtcttccagaagtaaccgcttcacctggatg
ggactttcagatctaaatcaggaaggcacgtggcaatgggtggacggctcacctctgttg
cccagcttcaagcagtattggaacagaggagagcccaacaacgttggggaggaagactgc
gcggaatttagtggcaatggctggaacgacgacaaatgtaatcttgccaaattctggatc
tgcaaaaagtccgcagcctcctgctccagggatgaagaacagtttctttctccagcccct
gccaccccaaacccccctcctgcgtag

DBGET integrated database retrieval system