KEGG   Homo sapiens (human): 30835Help
Entry
30835             CDS       T01001                                 

Gene name
CD209, CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1
Definition
CD209 molecule
Orthology
K06563  
CD209 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Tuberculosis
Measles
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13
AA seq 268 aa AA seqDB search
MSDSKEPRLQQLGLLVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQEL
TQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVERLCHPC
PWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM
GLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWI
CKKSAASCSRDEEQFLSPAPATPNPPPA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagactgcagcagctgggcctcctggtgtccaaggtcccc
agctccataagtcaggaacaatccaggcaagacgcgatctaccagaacctgacccagctt
aaagctgcagtgggtgagctctcagagaaatccaagctgcaggagatctaccaggagctg
acccagctgaaggctgcagtgggtgagcttccagagaaatctaagctgcaggagatctac
caggagctgacccggctgaaggctgcagtgggtgagcttccagagaaatctaagctgcag
gagatctaccaggagctgacctggctgaaggctgcagtggaacgcctgtgccacccctgt
ccctgggaatggacattcttccaaggaaactgttacttcatgtctaactcccagcggaac
tggcacgactccatcaccgcctgcaaagaagtgggggcccagctcgtcgtaatcaaaagt
gctgaggagcagaacttcctacagctgcagtcttccagaagtaaccgcttcacctggatg
ggactttcagatctaaatcaggaaggcacgtggcaatgggtggacggctcacctctgttg
cccagcttcaagcagtattggaacagaggagagcccaacaacgttggggaggaagactgc
gcggaatttagtggcaatggctggaacgacgacaaatgtaatcttgccaaattctggatc
tgcaaaaagtccgcagcctcctgctccagggatgaagaacagtttctttctccagcccct
gccaccccaaacccccctcctgcgtag

DBGET integrated database retrieval system