KEGG   Homo sapiens (human): 31Help
Entry
31                CDS       T01001                                 

Gene name
ACACA, ACAC, ACACAD, ACC, ACC1, ACCA
Definition
(RefSeq) acetyl-CoA carboxylase alpha (EC:6.4.1.2 6.3.4.14)
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    31 (ACACA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    31 (ACACA)
   00640 Propanoate metabolism
    31 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    31 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    31 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    31 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    31 (ACACA)
   04922 Glucagon signaling pathway
    31 (ACACA)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     31 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     31 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 2346 aa AA seqDB search
MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
DLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSP
PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLV
DHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQA
FLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVI
GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVD
PEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGS
GMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPID
RIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE
EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILST
MDSPST
NT seq 7041 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccatctcccttggcccaacctctggagctgaaccagcactctcgattcata
ataggttctgtgtctgaagataactcagaggatgagatcagcaacctggtgaagttggac
ctactggaggagaaggagggctccttgtcacctgcttctgttggctcagatacactctct
gatttggggatctctagcctacaggatggcttggccttgcacataaggtccagcatgtct
ggcttgcacctagtaaagcagggccgagacagaaagaaaatagattctcaacgagatttc
actgtggcttctccagcagaatttgttactcgctttgggggaaataaagtgattgagaag
gttcttattgctaacaatggcattgcagcagtgaaatgcatgcggtctatccgtaggtgg
tcttatgaaatgtttcgaaatgaacgtgcaattagattcgttgtcatggtcacacctgaa
gaccttaaagccaatgcagaatacattaagatggcagatcactatgtgccagtgcctgga
ggaccaaacaacaacaactatgcaaatgtggaattaattcttgatattgctaaaaggatc
ccagtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaaactaccggaa
cttctcttgaaaaatggcattgccttcatgggtcctccaagccaggccatgtgggcttta
ggggataagattgcatcttccatagtggctcaaactgcaggtatcccaactcttccctgg
agcggcagtggtcttcgtgtggactggcaggaaaatgatttttcaaaacgtatcttaaat
gttccccaggagctatatgaaaaaggttatgtgaaagatgtggatgatgggctacaggca
gctgaggaagttggatatccagtaatgatcaaggcctcagagggaggaggagggaaggga
attagaaaagtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaa
gttcctggatctcccatatttgtgatgagactagccaaacaatctcgtcatctggaggtg
cagatcttagcggaccaatatggcaatgctatctctttgtttggtcgtgattgctctgta
caacgcaggcatcagaagattattgaagaagcacctgctactattgctactccagcagta
tttgaacacatggaacagtgtgcggtgaaacttgccaaaatggtgggttatgtgagtgct
gggactgtggaatacctgtacagccaggatggcagcttctactttctggaattgaatcct
cggctgcaggtagagcacccttgtacagagatggtggctgatgtcaatctccctgcagca
cagctccagattgccatggggattcctctatatagaatcaaggatatccgtatgatgtat
ggggtatctccctggggtgattctcccattgattttgaagattctgcacacgttccttgt
ccaaggggccatgttattgctgctcggatcactagtgaaaatccagatgagggttttaag
cccagctcaggaacagttcaggagctaaatttccgcagcaataagaatgtttggggatat
ttcagtgttgctgctgcagggggacttcatgaatttgctgattctcagtttggtcactgc
ttttcttggggagaaaacagagaagaggcaatttcaaacatggtggtggctttgaaggag
ctgtctattcggggtgactttcgaactacagttgaatacctgatcaaattgttagagact
gaaagctttcagatgaacagaattgatactggctggctggacagactgatagcagaaaaa
gtacaggctgagcgacctgacaccatgttgggggttgtgtgtggtgccctccacgtggca
gatgtgagcctgcggaatagcgtctctaacttccttcactccttagaaaggggtcaagtc
cttcctgctcatacacttctgaatacagtagatgttgaacttatctatgagggagtcaag
tatgtacttaaggtgactcgacagtcccccaactcctatgtggtgatcatgaatggctca
tgtgtagaagtagatgtacatcggctgagtgacggtggactgctcttgtcctatgatggc
agcagttatactacgtatatgaaagaggaagtggatagatatcgcatcacaattggcaat
aaaacctgtgtgtttgagaaggaaaatgacccatcggtgatgcgctcaccttctgctggg
aagttaatccagtacattgtagaagatggaggtcatgtgtttgccggccagtgctatgct
gagattgaggtaatgaagatggtaatgaccttaacagctgtggagtctggctgtatccat
tacgtcaagcgacctggagcagctcttgaccctggctgtgtactagccaaaatgcaactg
gacaaccccagcaaggttcagcaggctgaacttcacacaggtagtctgccacggatccag
agcacggcactcagaggcgagaaactccatcgagtgttccattatgtcctggataatctg
gtcaatgtaatgaatggatactgccttccagatcctttctttagcagcaaggtaaaagac
tgggtagagcgattgatgaaaaccctcagagatccctccctgcctctcctagaattgcaa
gatattatgaccagtgtgtctggccgcattccccccaatgtggagaagtctatcaagaag
gaaatggctcagtatgctagcaacatcacatcagtcctctgtcagtttcccagccagcag
attgcaaacatcctagatagccatgcagctacattgaaccggaaatctgaacgggaagtc
ttctttatgaatactcagagcattgttcagctggtacagaggtaccgaagtggcatccga
ggccacatgaaggctgtggtgatggatctgctccggcagtacctgcgagtagagacacaa
ttccagaatggtcactatgacaaatgtgtattcgccctccgagaagagaataaaagtgac
atgaacactgtactgaactacatcttctctcacgctcaagtcaccaagaagaatcttctg
gtcacaatgcttattgatcagttgtgtggccgggaccctactctcactgatgagctgctg
aatattctcacagagctaactcaactcagtaagaccaccaatgccaaagtagcacttcga
gcacgccaggttcttattgcctcccatttgccatcatatgagcttcgccataaccaagta
gagtctatcttcctatcagctattgacatgtatggacatcaattttgcattgagaacctg
cagaaactcatcctatcagaaacatctatttttgatgtcctaccaaacttcttctatcac
agcaaccaagtagtgaggatggcagctctggaggtgtatgttcgaagggcttatattgcc
tatgaacttaacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaattc
cagttcatgctgcccacatctcatccaaacagagggaacatccctacgctaaacagaatg
tccttctcctccaacctcaaccactatggcatgacccatgtagctagtgtcagcgatgta
ctgttggacaactcattcactccaccttgtcagcggatgggcggaatggtctcttttcgg
acttttgaagattttgtcaggatctttgatgaagtgatgggctgcttctctgactcccca
ccccagagtcccacattccctgaggcaggtcacacgtctctttatgatgaggataaggtt
cccagggatgaaccaattcacattctcaatgtggctatcaagactgactgtgatattgag
gatgacaggctggcagctatgttcagagaatttacccagcaaaataaagctaccctggtt
gaccatgggatccggcgccttactttcctggttgcacaaaaggatttcagaaagcaggtc
aactatgaggtggatcggagatttcatagagaattccctaaattttttacattccgagca
agggataagtttgaggaggatcgtatctatcgtcatctggagcctgctctggctttccag
ttagagctgaaccggatgagaaattttgacctcactgccattccatgtgctaatcacaag
atgcacctgtatctcggggcagccaaggtggaagtgggcacagaagtgacagactacagg
ttctttgttcgtgcaatcatcaggcattctgatctggtcaccaaggaagcttcttttgaa
tatctgcaaaatgaaggggagcggctactcctggaagccatggatgagttggaagttgct
tttaacaatacaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacg
gttatcatggacccatcaaagattgaggaatccgtgcggagcatggtaatgcggtatgga
agtcgcctgtggaaattgcgcgtcctccaggcagaactgaaaatcaacattcgcctgacg
ccaactggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttg
gatatcagcctatacaaggaagtgactgactccaggacagcacagatcatgtttcaggca
tatggagacaaacagggaccactgcatggaatgttaatcaatactccatatgtgaccaaa
gacctgctgcaatcaaagaggttccaggcacaatccttagggacaacatacatatatgat
atcccagagatgtttcggcagtccctgatcaaactctgggagtctatgtccactcaagca
tttcttccatctccccctctgccttctgacatgctgacttacactgaactggtactggat
gatcaaggtcagctggtccacatgaacaggcttccaggaggaaatgagattggcatggta
gcttggaaaatgacctttaaaagtcctgaatatccagaaggccgagatatcattgttatt
ggcaatgacatcacataccgaattgggtcctttgggcctcaagaggatttgttatttctc
agagcttccgaacttgctagggcagaaggtattccacgcatctatgtatcagccaacagt
ggagcaagaatcggactggcagaagaaattcgccatatgtttcatgtggcctgggtagat
cctgaggatccttacaagggatacaggtatttatatctgactcctcaagattataagaga
gtcagtgctctcaactctgtccattgtgaacacgtggaagatgaaggagaatccaggtac
aagataacagatattattgggaaagaagagggaattggacccgagaaccttcgaggttct
ggaatgattgctggagaatcctcattggcctataatgagatcattaccatcagcctggtg
acgtgccgggccattgggattggggcttaccttgtccggctgggacagagaaccatccag
gttgagaattctcacttaattctaacaggagctggagccctcaacaaagtcctcgggcgg
gaagtgtacacctccaataaccagctggggggcatccagattatgcacaacaatggggtg
acccactgcactgtgtgtgatgactttgaaggggttttcactgtcctgcactggctgtct
tacatgcccaagagcgtgcacagttcagttcctcttctgaactcaaaggatcctatagac
agaatcatcgagtttgttcccacaaagaccccatacgatcctcgatggatgctagcaggc
cgtcctcacccaacccaaaaaggtcagtggttgagtggcttttttgactatggatctttc
tcagagattatgcagccctgggcacagactgtggtggttggtagagccaggctaggagga
atacctgtgggagttgttgctgtagaaacccgaacagtagaactaagtatcccagctgat
ccagcaaacctggattctgaagccaagataatccagcaggctggccaggtttggttccca
gattctgcgtttaagacgtatcaggccatcaaggacttcaaccgggaagggctgcctctg
atggtctttgccaactggagaggcttctctggtggaatgaaagatatgtacgaccaagtg
ctgaagtttggtgcttacattgtggatggcttgagggagtgctgccagcctgtgctggtt
tacattcctccccaggctgagctgcggggtggctcctgggtggtgattgactcctccatc
aacccccggcacatggagatgtatgctgaccgagaaagcaggggatctgttctggagcca
gaagggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtg
gacccagtctacatccacttggctgagcgattggggaccccagagctaagcacagctgag
cggaaggagttggagaacaagttgaaggagcgggaggaattcctaattcccatttaccat
caggtagccgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggt
gttattagcgatatcctggattggaaaacatcccgtaccttcttctactggcggctgagg
cgtcttctgctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgact
gatggccagattcaagccatgttaaggcgctggtttgtggaagtggaaggaacagtgaag
gcttatgtttgggacaataataaggatctggcggagtggctagagaaacagctgacagag
gaggatggtgttcactcggtaatagaggaaaacatcaaatgcatcagcagagactacgtc
ctcaagcaaatccgcagcttggtccaggccaatccagaggttgccatggattccatcatc
catatgacgcagcacatatcacccactcagcgagcagaagtcatacggatcctctccaca
atggattccccttccacgtag

DBGET integrated database retrieval system