KEGG   Homo sapiens (human): 3106Help
Entry
3106              CDS       T01001                                 

Gene name
HLA-B, AS, B-4901, HLAB
Definition
(RefSeq) major histocompatibility complex, class I, B
  KO
K06751  major histocompatibility complex, class I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00184  KSHV MIR1/2 to MHC1-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00344  Leprosy
H01476  Behcet disease
H01507  Seronegative arthritis (SpA)
H01674  Ankylosing spondylitis
H01694  Stevens-Johnson syndrome and toxic epidermal necrolysis
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3106 (HLA-B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3106 (HLA-B)
   04145 Phagosome
    3106 (HLA-B)
  Cell growth and death
   04218 Cellular senescence
    3106 (HLA-B)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3106 (HLA-B)
   04612 Antigen processing and presentation
    3106 (HLA-B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3106 (HLA-B)
  Immune diseases
   05320 Autoimmune thyroid disease
    3106 (HLA-B)
   05330 Allograft rejection
    3106 (HLA-B)
   05332 Graft-versus-host disease
    3106 (HLA-B)
  Cardiovascular diseases
   05416 Viral myocarditis
    3106 (HLA-B)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3106 (HLA-B)
  Infectious diseases
   05166 HTLV-I infection
    3106 (HLA-B)
   05168 Herpes simplex infection
    3106 (HLA-B)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3106 (HLA-B)
   05169 Epstein-Barr virus infection
    3106 (HLA-B)
   05165 Human papillomavirus infection
    3106 (HLA-B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3106 (HLA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3106 (HLA-B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3106
NCBI-ProteinID: NP_005505
OMIM: 142830
HGNC: 4932
Ensembl: ENSG00000234745
Vega: OTTHUMG00000031153
Pharos: P01889(Tbio)
UniProt: P01889 E5FQ95
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 362 aa AA seqDB search
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

DBGET integrated database retrieval system