KEGG   Homo sapiens (human): 3106Help
Entry
3106              CDS       T01001                                 

Gene name
HLA-B, AS, HLAB, SPDA1
Definition
major histocompatibility complex, class I, B
Orthology
K06751  
major histocompatibility complex, class I
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00344  
Leprosy
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 362 aa AA seqDB search
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

DBGET integrated database retrieval system