KEGG   Homo sapiens (human): 3108Help
Entry
3108              CDS       T01001                                 

Gene name
HLA-DMA, D6S222E, DMA, HLADM, RING6
Definition
major histocompatibility complex, class II, DM alpha
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00083  
Allograft rejection
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 261 aa AA seqDB search
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVD
GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgaacagaaccaaggagctgcgctgctacagatgttaccacttctgtggctg
ctaccccactcctgggccgtccctgaagctcctactccaatgtggccagatgacctgcaa
aaccacacattcctgcacacagtgtactgccaggatgggagtcccagtgtgggactctct
gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct
cgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt
gacaaagagttctgcgagtggatgatccagcaaatagggccaaaacttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaagtgttcacgctgaagcccctggagtttggc
aagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggatttgggcctacttttgtctcagctgtcgat
ggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtaccccgg
aacgcactgccctcagatctgctggagaatgtgctgtgtggcgtggcctttggcctgggt
gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt
gactga

DBGET integrated database retrieval system