KEGG   Homo sapiens (human): 3111Help
Entry
3111              CDS       T01001                                 

Gene name
HLA-DOA, HLA-DNA, HLA-DZA, HLADZ
Definition
major histocompatibility complex, class II, DO alpha
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3111 (HLA-DOA)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3111 (HLA-DOA)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3111 (HLA-DOA)
   04672 Intestinal immune network for IgA production
    3111 (HLA-DOA)
 Human Diseases
  Immune diseases
   05310 Asthma
    3111 (HLA-DOA)
   05322 Systemic lupus erythematosus
    3111 (HLA-DOA)
   05323 Rheumatoid arthritis
    3111 (HLA-DOA)
   05320 Autoimmune thyroid disease
    3111 (HLA-DOA)
   05321 Inflammatiory bowel disease (IBD)
    3111 (HLA-DOA)
   05330 Allograft rejection
    3111 (HLA-DOA)
   05332 Graft-versus-host disease
    3111 (HLA-DOA)
  Cardiovascular diseases
   05416 Viral myocarditis
    3111 (HLA-DOA)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3111 (HLA-DOA)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3111 (HLA-DOA)
   05152 Tuberculosis
    3111 (HLA-DOA)
   05166 HTLV-I infection
    3111 (HLA-DOA)
   05164 Influenza A
    3111 (HLA-DOA)
   05168 Herpes simplex infection
    3111 (HLA-DOA)
   05145 Toxoplasmosis
    3111 (HLA-DOA)
   05140 Leishmaniasis
    3111 (HLA-DOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3111 (HLA-DOA)
  Exosomal proteins of epithelial cells
   3111 (HLA-DOA)
  Exosomal proteins of breast milk
   3111 (HLA-DOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 250 aa AA seqDB search
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccctcagagcagggctggtcctggggttccacaccctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggcgcctcgggccagttcacccatgaatttgatgaggaacagctgttctctgtg
gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggtgactttgcccgcttt
gacccgcagggcgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg
gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag
tctcgggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaacggccaaactgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagccgaggacgtctatgactgccaggtggagcactggggcctggatgcgccactc
ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc
tgtgccctgggcctggccatcggcctggtgggcttcctcgtgggcaccgtcctcatcatc
atgggcacatatgtgtccagtgtccccaggtaa

DBGET integrated database retrieval system