KEGG   Homo sapiens (human): 3112Help
Entry
3112              CDS       T01001                                 

Gene name
HLA-DOB, DOB
Definition
major histocompatibility complex, class II, DO beta
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3112 (HLA-DOB)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3112 (HLA-DOB)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3112 (HLA-DOB)
   04672 Intestinal immune network for IgA production
    3112 (HLA-DOB)
 Human Diseases
  Immune diseases
   05310 Asthma
    3112 (HLA-DOB)
   05322 Systemic lupus erythematosus
    3112 (HLA-DOB)
   05323 Rheumatoid arthritis
    3112 (HLA-DOB)
   05320 Autoimmune thyroid disease
    3112 (HLA-DOB)
   05321 Inflammatiory bowel disease (IBD)
    3112 (HLA-DOB)
   05330 Allograft rejection
    3112 (HLA-DOB)
   05332 Graft-versus-host disease
    3112 (HLA-DOB)
  Cardiovascular diseases
   05416 Viral myocarditis
    3112 (HLA-DOB)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3112 (HLA-DOB)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3112 (HLA-DOB)
   05152 Tuberculosis
    3112 (HLA-DOB)
   05166 HTLV-I infection
    3112 (HLA-DOB)
   05164 Influenza A
    3112 (HLA-DOB)
   05168 Herpes simplex infection
    3112 (HLA-DOB)
   05145 Toxoplasmosis
    3112 (HLA-DOB)
   05140 Leishmaniasis
    3112 (HLA-DOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3112 (HLA-DOB)
  Exosomal proteins of epithelial cells
   3112 (HLA-DOB)
  Exosomal proteins of breast milk
   3112 (HLA-DOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 273 aa AA seqDB search
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc
gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg
ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaagtggttcctgaat
gggcaggaggagagagctggggtcatgtccactggccctatcaggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt
gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat
tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt
aatgaggtctcaagagctgttctgctccctcagtcatgctaa

DBGET integrated database retrieval system