KEGG   Homo sapiens (human): 3117Help
Entry
3117              CDS       T01001                                 

Gene name
HLA-DQA1, CD, CELIAC1, DQ-A1, GSE, HLA-DQA
Definition
major histocompatibility complex, class II, DQ alpha 1
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00080  
Systemic lupus erythematosus
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00294  
Dilated cardiomyopathy (DCM)
H00408  
Type I diabetes mellitus
H01362  
Dermatitis herpetiformis
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 255 aa AA seqDB search
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV
DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag
ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt
gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt
aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc
tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga

DBGET integrated database retrieval system