KEGG   Homo sapiens (human): 3117Help
Entry
3117              CDS       T01001                                 

Gene name
HLA-DQA1, CELIAC1, DQ-A1, HLA-DQA
Definition
(RefSeq) major histocompatibility complex, class II, DQ alpha 1
  KO
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00080  
Systemic lupus erythematosus
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00294  
Dilated cardiomyopathy (DCM)
H00408  
Type I diabetes mellitus
H01362  
Dermatitis herpetiformis
H01492  
Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3117 (HLA-DQA1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3117 (HLA-DQA1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3117 (HLA-DQA1)
   04612 Antigen processing and presentation
    3117 (HLA-DQA1)
   04658 Th1 and Th2 cell differentiation
    3117 (HLA-DQA1)
   04672 Intestinal immune network for IgA production
    3117 (HLA-DQA1)
 Human Diseases
  Immune diseases
   05310 Asthma
    3117 (HLA-DQA1)
   05322 Systemic lupus erythematosus
    3117 (HLA-DQA1)
   05323 Rheumatoid arthritis
    3117 (HLA-DQA1)
   05320 Autoimmune thyroid disease
    3117 (HLA-DQA1)
   05321 Inflammatiory bowel disease (IBD)
    3117 (HLA-DQA1)
   05330 Allograft rejection
    3117 (HLA-DQA1)
   05332 Graft-versus-host disease
    3117 (HLA-DQA1)
  Cardiovascular diseases
   05416 Viral myocarditis
    3117 (HLA-DQA1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3117 (HLA-DQA1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3117 (HLA-DQA1)
   05152 Tuberculosis
    3117 (HLA-DQA1)
   05166 HTLV-I infection
    3117 (HLA-DQA1)
   05164 Influenza A
    3117 (HLA-DQA1)
   05168 Herpes simplex infection
    3117 (HLA-DQA1)
   05169 Epstein-Barr virus infection
    3117 (HLA-DQA1)
   05145 Toxoplasmosis
    3117 (HLA-DQA1)
   05140 Leishmaniasis
    3117 (HLA-DQA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3117 (HLA-DQA1)
  Exosomal proteins of epithelial cells
   3117 (HLA-DQA1)
  Exosomal proteins of breast milk
   3117 (HLA-DQA1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    CD4; CD4 antigen [KO:K06454]
     3117 (HLA-DQA1)
    LAG3; lymphocyte-activation gene 3 protein [KO:K06565]
     3117 (HLA-DQA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 255 aa AA seqDB search
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV
DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag
ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt
gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt
aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc
tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga

DBGET integrated database retrieval system