KEGG   Homo sapiens (human): 3118Help
Entry
3118              CDS       T01001                                 

Gene name
HLA-DQA2, DX-ALPHA, HLA-DXA
Definition
(RefSeq) major histocompatibility complex, class II, DQ alpha 2
  KO
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3118 (HLA-DQA2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3118 (HLA-DQA2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3118 (HLA-DQA2)
   04612 Antigen processing and presentation
    3118 (HLA-DQA2)
   04658 Th1 and Th2 cell differentiation
    3118 (HLA-DQA2)
   04659 Th17 cell differentiation
    3118 (HLA-DQA2)
   04672 Intestinal immune network for IgA production
    3118 (HLA-DQA2)
 Human Diseases
  Immune diseases
   05310 Asthma
    3118 (HLA-DQA2)
   05322 Systemic lupus erythematosus
    3118 (HLA-DQA2)
   05323 Rheumatoid arthritis
    3118 (HLA-DQA2)
   05320 Autoimmune thyroid disease
    3118 (HLA-DQA2)
   05321 Inflammatiory bowel disease (IBD)
    3118 (HLA-DQA2)
   05330 Allograft rejection
    3118 (HLA-DQA2)
   05332 Graft-versus-host disease
    3118 (HLA-DQA2)
  Cardiovascular diseases
   05416 Viral myocarditis
    3118 (HLA-DQA2)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3118 (HLA-DQA2)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3118 (HLA-DQA2)
   05152 Tuberculosis
    3118 (HLA-DQA2)
   05166 HTLV-I infection
    3118 (HLA-DQA2)
   05164 Influenza A
    3118 (HLA-DQA2)
   05168 Herpes simplex infection
    3118 (HLA-DQA2)
   05169 Epstein-Barr virus infection
    3118 (HLA-DQA2)
   05145 Toxoplasmosis
    3118 (HLA-DQA2)
   05140 Leishmaniasis
    3118 (HLA-DQA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3118 (HLA-DQA2)
  Exosomal proteins of epithelial cells
   3118 (HLA-DQA2)
  Exosomal proteins of breast milk
   3118 (HLA-DQA2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    CD4; CD4 antigen [KO:K06454]
     3118 (HLA-DQA2)
    LAG3; lymphocyte-activation gene 3 protein [KO:K06565]
     3118 (HLA-DQA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P01906(Tbio)
UniProt: 
Position
6p21.32
AA seq 255 aa AA seqDB search
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccatgttgcctcctatggtgtgaacttctaccag
tctcacggtccctctggccagtacacccatgaatttgatggagacgaggagttctatgtg
gacctggagacgaaagagactgtctggcagttgcctatgtttagcaaatttataagtttt
gacccgcagagtgcactgagaaatatggctgtgggaaaacacaccttggaattcatgatg
agacagtccaactctaccgctgccaccaatgaggttcctgaggtcacagtgttttccaag
tttcctgtgacgctgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtcaacatcacctggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactttggtc
tgcgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggctcttatga

DBGET integrated database retrieval system