KEGG   Homo sapiens (human): 3119Help
Entry
3119              CDS       T01001                                 

Gene name
HLA-DQB1, CELIAC1, HLA-DQB, IDDM1
Definition
major histocompatibility complex, class II, DQ beta 1
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00079  
Asthma
H00080  
Systemic lupus erythematosus
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00294  
Dilated cardiomyopathy (DCM)
H00295  
Viral myocarditis
H00342  
Tuberculosis
H00408  
Type I diabetes mellitus
H01362  
Dermatitis herpetiformis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3119 (HLA-DQB1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3119 (HLA-DQB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3119 (HLA-DQB1)
   04672 Intestinal immune network for IgA production
    3119 (HLA-DQB1)
 Human Diseases
  Immune diseases
   05310 Asthma
    3119 (HLA-DQB1)
   05322 Systemic lupus erythematosus
    3119 (HLA-DQB1)
   05323 Rheumatoid arthritis
    3119 (HLA-DQB1)
   05320 Autoimmune thyroid disease
    3119 (HLA-DQB1)
   05321 Inflammatiory bowel disease (IBD)
    3119 (HLA-DQB1)
   05330 Allograft rejection
    3119 (HLA-DQB1)
   05332 Graft-versus-host disease
    3119 (HLA-DQB1)
  Cardiovascular diseases
   05416 Viral myocarditis
    3119 (HLA-DQB1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3119 (HLA-DQB1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3119 (HLA-DQB1)
   05152 Tuberculosis
    3119 (HLA-DQB1)
   05166 HTLV-I infection
    3119 (HLA-DQB1)
   05164 Influenza A
    3119 (HLA-DQB1)
   05168 Herpes simplex infection
    3119 (HLA-DQB1)
   05169 Epstein-Barr virus infection
    3119 (HLA-DQB1)
   05145 Toxoplasmosis
    3119 (HLA-DQB1)
   05140 Leishmaniasis
    3119 (HLA-DQB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3119 (HLA-DQB1)
  Exosomal proteins of epithelial cells
   3119 (HLA-DQB1)
  Exosomal proteins of breast milk
   3119 (HLA-DQB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 269 aa AA seqDB search
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVT
RYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFR
GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRQRSQKGPQGPPPAGLLH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaagaaggctttgcggatccccggagaccttcgggtagcaactgtcaccttg
atgctggcgatgctgagctccctactggctgagggcagagactctcccgaggatttcgtg
ttccagtttaagggcatgtgctacttcaccaacgggacggagcgcgtgcgtcttgtgacc
agatacatctataaccgagaggagtacgcgcgcttcgacagcgacgtgggggtgtaccgc
gcggtgacgccgcaggggcggcctgatgccgagtactggaacagccagaaggaagtcctg
gaggggacccgggcggagttggacacggtgtgcagacacaactacgaggtggcgttccgc
gggatcttgcagaggagagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgatcaggaggagacagccggcgttgtgtccaccccccttatt
aggaatggtgactggactttccagatcctggtgatgctggaaatgactccccagcgtgga
gatgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggcgttggaggcttcgtgctg
gggctgatcttccttgggctgggccttatcatccgtcaaaggagtcagaaaggacctcaa
gggcctccaccagcagggcttctgcactga

DBGET integrated database retrieval system