KEGG   Homo sapiens (human): 3123Help
Entry
3123              CDS       T01001                                 

Gene name
HLA-DRB1, DRB1, DRw10, HLA-DR1B, HLA-DRB, SS1
Definition
major histocompatibility complex, class II, DR beta 1
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00079  
Asthma
H00080  
Systemic lupus erythematosus
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00294  
Dilated cardiomyopathy (DCM)
H00342  
Tuberculosis
H00408  
Type I diabetes mellitus
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 266 aa AA seqDB search
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF
HNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV
QRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggagtactct
acgtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgatgccgagtactggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaactactgcagacacaactacggggttgtggagagcttcacagtg
cagcggcgagtccatcctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cataacctcctggtctgttctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaagactggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaagaggattcctgagctga

DBGET integrated database retrieval system