KEGG   Homo sapiens (human): 3125Help
Entry
3125              CDS       T01001                                 

Gene name
HLA-DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 3
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3125 (HLA-DRB3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3125 (HLA-DRB3)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3125 (HLA-DRB3)
   04612 Antigen processing and presentation
    3125 (HLA-DRB3)
   04658 Th1 and Th2 cell differentiation
    3125 (HLA-DRB3)
   04659 Th17 cell differentiation
    3125 (HLA-DRB3)
   04672 Intestinal immune network for IgA production
    3125 (HLA-DRB3)
 Human Diseases
  Immune diseases
   05310 Asthma
    3125 (HLA-DRB3)
   05322 Systemic lupus erythematosus
    3125 (HLA-DRB3)
   05323 Rheumatoid arthritis
    3125 (HLA-DRB3)
   05320 Autoimmune thyroid disease
    3125 (HLA-DRB3)
   05321 Inflammatiory bowel disease (IBD)
    3125 (HLA-DRB3)
   05330 Allograft rejection
    3125 (HLA-DRB3)
   05332 Graft-versus-host disease
    3125 (HLA-DRB3)
  Cardiovascular diseases
   05416 Viral myocarditis
    3125 (HLA-DRB3)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3125 (HLA-DRB3)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3125 (HLA-DRB3)
   05152 Tuberculosis
    3125 (HLA-DRB3)
   05166 HTLV-I infection
    3125 (HLA-DRB3)
   05164 Influenza A
    3125 (HLA-DRB3)
   05168 Herpes simplex infection
    3125 (HLA-DRB3)
   05169 Epstein-Barr virus infection
    3125 (HLA-DRB3)
   05145 Toxoplasmosis
    3125 (HLA-DRB3)
   05140 Leishmaniasis
    3125 (HLA-DRB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3125 (HLA-DRB3)
  Exosomal proteins of epithelial cells
   3125 (HLA-DRB3)
  Exosomal proteins of breast milk
   3125 (HLA-DRB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202 I-set
Motif
Other DBs
NCBI-GeneID: 3125
NCBI-ProteinID: NP_072049
OMIM: 612735
HGNC: 4951
Pharos: P79483(Tchem)
UniProt: P79483
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 266 aa AA seqDB search
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctccagcttggcagcgttgacagtgacactgatg
gtgctgagctcccgactggctttcgctggggacacccgaccacgtttcttggagctgcgt
aagtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagttcctgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgtcgccgagtcctggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaattactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacgggcctgatccagaatgga
gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac
acttgccaagtggagcacccaagcgtaacgagcgctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggattcctgagctga

DBGET integrated database retrieval system