KEGG   Homo sapiens (human): 3127Help
Entry
3127              CDS       T01001                                 

Gene name
HLA-DRB5
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 5
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3127 (HLA-DRB5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3127 (HLA-DRB5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3127 (HLA-DRB5)
   04612 Antigen processing and presentation
    3127 (HLA-DRB5)
   04658 Th1 and Th2 cell differentiation
    3127 (HLA-DRB5)
   04659 Th17 cell differentiation
    3127 (HLA-DRB5)
   04672 Intestinal immune network for IgA production
    3127 (HLA-DRB5)
 Human Diseases
  Immune diseases
   05310 Asthma
    3127 (HLA-DRB5)
   05322 Systemic lupus erythematosus
    3127 (HLA-DRB5)
   05323 Rheumatoid arthritis
    3127 (HLA-DRB5)
   05320 Autoimmune thyroid disease
    3127 (HLA-DRB5)
   05321 Inflammatiory bowel disease (IBD)
    3127 (HLA-DRB5)
   05330 Allograft rejection
    3127 (HLA-DRB5)
   05332 Graft-versus-host disease
    3127 (HLA-DRB5)
  Cardiovascular diseases
   05416 Viral myocarditis
    3127 (HLA-DRB5)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3127 (HLA-DRB5)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3127 (HLA-DRB5)
   05152 Tuberculosis
    3127 (HLA-DRB5)
   05166 HTLV-I infection
    3127 (HLA-DRB5)
   05164 Influenza A
    3127 (HLA-DRB5)
   05168 Herpes simplex infection
    3127 (HLA-DRB5)
   05169 Epstein-Barr virus infection
    3127 (HLA-DRB5)
   05145 Toxoplasmosis
    3127 (HLA-DRB5)
   05140 Leishmaniasis
    3127 (HLA-DRB5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3127 (HLA-DRB5)
  Exosomal proteins of epithelial cells
   3127 (HLA-DRB5)
  Exosomal proteins of breast milk
   3127 (HLA-DRB5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    CD4; CD4 antigen [KO:K06454]
     3127 (HLA-DRB5)
    LAG3; lymphocyte-activation gene 3 protein [KO:K06565]
     3127 (HLA-DRB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 3127
NCBI-ProteinID: NP_002116
OMIM: 604776
HGNC: 4953
Ensembl: ENSG00000198502
Vega: OTTHUMG00000031027
Pharos: Q30154(Tbio)
UniProt: Q30154
Structure
PDB: 

Jmol
Position
6p21.32
AA seq 266 aa AA seqDB search
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggttcctacatggcaaagctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgcagcaggat
aagtatgagtgtcatttcttcaacgggacggagcgggtgcggttcctgcacagagacatc
tataaccaagaggaggacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacttcctggaagacagg
cgcgccgcggtggacacctactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagttgagcctaaggtgactgtgtatcctgcaaggacccagaccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacagccaggaagagaaggctggggtggtgtccacaggcctgattcagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac
acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacag
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctattcatctacttcaagaatcagaaagggcactctggacttcac
ccaacaggactcgtgagctga

DBGET integrated database retrieval system