KEGG   Homo sapiens (human): 3135Help
Entry
3135              CDS       T01001                                 

Gene name
HLA-G, MHC-G
Definition
(RefSeq) major histocompatibility complex, class I, G
  KO
K06751  major histocompatibility complex, class I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00184  KSHV MIR1/2 to MHC1-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3135 (HLA-G)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3135 (HLA-G)
   04145 Phagosome
    3135 (HLA-G)
  Cell growth and death
   04218 Cellular senescence
    3135 (HLA-G)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3135 (HLA-G)
   04612 Antigen processing and presentation
    3135 (HLA-G)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3135 (HLA-G)
  Immune diseases
   05320 Autoimmune thyroid disease
    3135 (HLA-G)
   05330 Allograft rejection
    3135 (HLA-G)
   05332 Graft-versus-host disease
    3135 (HLA-G)
  Cardiovascular diseases
   05416 Viral myocarditis
    3135 (HLA-G)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3135 (HLA-G)
  Infectious diseases
   05166 HTLV-I infection
    3135 (HLA-G)
   05168 Herpes simplex infection
    3135 (HLA-G)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3135 (HLA-G)
   05169 Epstein-Barr virus infection
    3135 (HLA-G)
   05165 Human papillomavirus infection
    3135 (HLA-G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3135 (HLA-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3135 (HLA-G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 C2-set_2 ig SNO
Motif
Other DBs
NCBI-GeneID: 3135
NCBI-ProteinID: NP_002118
OMIM: 142871
HGNC: 4964
Ensembl: ENSG00000204632
Vega: OTTHUMG00000031157
Pharos: P17693(Tbio)
UniProt: P17693 Q6DU14
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 338 aa AA seqDB search
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgcggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaatg
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgtggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggagaaagaagagctcagattga

DBGET integrated database retrieval system