KEGG   Homo sapiens (human): 3156Help
Entry
3156              CDS       T01001                                 

Gene name
HMGCR, LDLCQ3
Definition
3-hydroxy-3-methylglutaryl-CoA reductase (EC:1.1.1.34)
Orthology
K00021  
hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
AMPK signaling pathway
Bile secretion
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Drug target
Simvastatin: 
Lovastatin: 
Pravastatin: 
Fluvastatin: 
Atorvastatin: 
Cerivastatin: 
Rosuvastatin: 
Pitavastatin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3156 (HMGCR)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    3156 (HMGCR)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    3156 (HMGCR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     3156 (HMGCR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.3-q14
AA seq 888 aa AA seqDB search
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagactttttcgaatgcatggcctctttgtggcctcccatccctgggaagtc
atagtggggacagtgacactgaccatctgcatgatgtccatgaacatgtttactggtaac
aataagatctgtggttggaattatgaatgtccaaagtttgaagaggatgttttgagcagt
gacattataattctgacaataacacgatgcatagccatcctgtatatttacttccagttc
cagaatttacgtcaacttggatcaaaatatattttgggtattgctggccttttcacaatt
ttctcaagttttgtattcagtacagttgtcattcacttcttagacaaagaattgacaggc
ttgaatgaagctttgccctttttcctacttttgattgacctttccagagcaagcacatta
gcaaagtttgccctcagttccaactcacaggatgaagtaagggaaaatattgctcgtgga
atggcaattttaggtcctacgtttaccctcgatgctcttgttgaatgtcttgtgattgga
gttggtaccatgtcaggggtacgtcagcttgaaattatgtgctgctttggctgcatgtca
gttcttgccaactacttcgtgttcatgactttcttcccagcttgtgtgtccttggtatta
gagctttctcgggaaagccgcgagggtcgtccaatttggcagctcagccattttgcccga
gttttagaagaagaagaaaataagccgaatcctgtaactcagagggtcaagatgattatg
tctctaggcttggttcttgttcatgctcacagtcgctggatagctgatccttctcctcaa
aacagtacagcagatacttctaaggtttcattaggactggatgaaaatgtgtccaagaga
attgaaccaagtgtttccctctggcagttttatctctctaaaatgatcagcatggatatt
gaacaagttattaccctaagtttagctctccttctggctgtcaagtacatcttctttgaa
caaacagagacagaatctacactctcattaaaaaaccctatcacatctcctgtagtgaca
caaaagaaagtcccagacaattgttgtagacgtgaacctatgctggtcagaaataaccag
aaatgtgattcagtagaggaagagacagggataaaccgagaaagaaaagttgaggttata
aaacccttagtggctgaaacagataccccaaacagagctacatttgtggttggtaactcc
tccttactcgatacttcatcagtactggtgacacaggaacctgaaattgaacttcccagg
gaacctcggcctaatgaagaatgtctacagatacttgggaatgcagagaaaggtgcaaaa
ttccttagtgatgctgagatcatccagttagtcaatgctaagcatatcccagcctacaag
ttggaaactctgatggaaactcatgagcgtggtgtatctattcgccgacagttactttcc
aagaagctttcagaaccttcttctctccagtacctaccttacagggattataattactcc
ttggtgatgggagcttgttgtgagaatgttattggatatatgcccatccctgttggagtg
gcaggacccctttgcttagatgaaaaagaatttcaggttccaatggcaacaacagaaggt
tgtcttgtggccagcaccaatagaggctgcagagcaataggtcttggtggaggtgccagc
agccgagtccttgcagatgggatgactcgtggcccagttgtgcgtcttccacgtgcttgt
gactctgcagaagtgaaagcctggctcgaaacatctgaagggttcgcagtgataaaggag
gcatttgacagcactagcagatttgcacgtctacagaaacttcatacaagtatagctgga
cgcaacctttatatccgtttccagtccaggtcaggggatgccatggggatgaacatgatt
tcaaagggtacagagaaagcactttcaaaacttcacgagtatttccctgaaatgcagatt
ctagccgttagtggtaactattgtactgacaagaaacctgctgctataaattggatagag
ggaagaggaaaatctgttgtttgtgaagctgtcattccagccaaggttgtcagagaagta
ttaaagactaccacagaggctatgattgaggtcaacattaacaagaatttagtgggctct
gccatggctgggagcataggaggctacaacgcccatgcagcaaacattgtcaccgccatc
tacattgcctgtggacaggatgcagcacagaatgttggtagttcaaactgtattacttta
atggaagcaagtggtcccacaaatgaagatttatatatcagctgcaccatgccatctata
gagataggaacggtgggtggtgggaccaacctactacctcagcaagcctgtttgcagatg
ctaggtgttcaaggagcatgcaaagataatcctggggaaaatgcccggcagcttgcccga
attgtgtgtgggaccgtaatggctggggaattgtcacttatggcagcattggcagcagga
catcttgtcaaaagtcacatgattcacaacaggtcgaagatcaatttacaagacctccaa
ggagcttgcaccaagaagacagcctga

DBGET integrated database retrieval system