KEGG   Homo sapiens (human): 3156Help
Entry
3156              CDS       T01001                                 

Gene name
HMGCR, LDLCQ3
Definition
3-hydroxy-3-methylglutaryl-CoA reductase (EC:1.1.1.34)
Orthology
K00021  
hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Bile secretion
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Drug target
Simvastatin: 
Lovastatin: 
Pravastatin: 
Fluvastatin: 
Atorvastatin: 
Cerivastatin: 
Rosuvastatin: 
Pitavastatin: 
Other: 
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hsa00900]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.3-q14
AA seq 888 aa AA seqDB search
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagactttttcgaatgcatggcctctttgtggcctcccatccctgggaagtc
atagtggggacagtgacactgaccatctgcatgatgtccatgaacatgtttactggtaac
aataagatctgtggttggaattatgaatgtccaaagtttgaagaggatgttttgagcagt
gacattataattctgacaataacacgatgcatagccatcctgtatatttacttccagttc
cagaatttacgtcaacttggatcaaaatatattttgggtattgctggccttttcacaatt
ttctcaagttttgtattcagtacagttgtcattcacttcttagacaaagaattgacaggc
ttgaatgaagctttgccctttttcctacttttgattgacctttccagagcaagcacatta
gcaaagtttgccctcagttccaactcacaggatgaagtaagggaaaatattgctcgtgga
atggcaattttaggtcctacgtttaccctcgatgctcttgttgaatgtcttgtgattgga
gttggtaccatgtcaggggtacgtcagcttgaaattatgtgctgctttggctgcatgtca
gttcttgccaactacttcgtgttcatgactttcttcccagcttgtgtgtccttggtatta
gagctttctcgggaaagccgcgagggtcgtccaatttggcagctcagccattttgcccga
gttttagaagaagaagaaaataagccgaatcctgtaactcagagggtcaagatgattatg
tctctaggcttggttcttgttcatgctcacagtcgctggatagctgatccttctcctcaa
aacagtacagcagatacttctaaggtttcattaggactggatgaaaatgtgtccaagaga
attgaaccaagtgtttccctctggcagttttatctctctaaaatgatcagcatggatatt
gaacaagttattaccctaagtttagctctccttctggctgtcaagtacatcttctttgaa
caaacagagacagaatctacactctcattaaaaaaccctatcacatctcctgtagtgaca
caaaagaaagtcccagacaattgttgtagacgtgaacctatgctggtcagaaataaccag
aaatgtgattcagtagaggaagagacagggataaaccgagaaagaaaagttgaggttata
aaacccttagtggctgaaacagataccccaaacagagctacatttgtggttggtaactcc
tccttactcgatacttcatcagtactggtgacacaggaacctgaaattgaacttcccagg
gaacctcggcctaatgaagaatgtctacagatacttgggaatgcagagaaaggtgcaaaa
ttccttagtgatgctgagatcatccagttagtcaatgctaagcatatcccagcctacaag
ttggaaactctgatggaaactcatgagcgtggtgtatctattcgccgacagttactttcc
aagaagctttcagaaccttcttctctccagtacctaccttacagggattataattactcc
ttggtgatgggagcttgttgtgagaatgttattggatatatgcccatccctgttggagtg
gcaggacccctttgcttagatgaaaaagaatttcaggttccaatggcaacaacagaaggt
tgtcttgtggccagcaccaatagaggctgcagagcaataggtcttggtggaggtgccagc
agccgagtccttgcagatgggatgactcgtggcccagttgtgcgtcttccacgtgcttgt
gactctgcagaagtgaaagcctggctcgaaacatctgaagggttcgcagtgataaaggag
gcatttgacagcactagcagatttgcacgtctacagaaacttcatacaagtatagctgga
cgcaacctttatatccgtttccagtccaggtcaggggatgccatggggatgaacatgatt
tcaaagggtacagagaaagcactttcaaaacttcacgagtatttccctgaaatgcagatt
ctagccgttagtggtaactattgtactgacaagaaacctgctgctataaattggatagag
ggaagaggaaaatctgttgtttgtgaagctgtcattccagccaaggttgtcagagaagta
ttaaagactaccacagaggctatgattgaggtcaacattaacaagaatttagtgggctct
gccatggctgggagcataggaggctacaacgcccatgcagcaaacattgtcaccgccatc
tacattgcctgtggacaggatgcagcacagaatgttggtagttcaaactgtattacttta
atggaagcaagtggtcccacaaatgaagatttatatatcagctgcaccatgccatctata
gagataggaacggtgggtggtgggaccaacctactacctcagcaagcctgtttgcagatg
ctaggtgttcaaggagcatgcaaagataatcctggggaaaatgcccggcagcttgcccga
attgtgtgtgggaccgtaatggctggggaattgtcacttatggcagcattggcagcagga
catcttgtcaaaagtcacatgattcacaacaggtcgaagatcaatttacaagacctccaa
ggagcttgcaccaagaagacagcctga

DBGET integrated database retrieval system