KEGG   Homo sapiens (human): 3158Help
Entry
3158              CDS       T01001                                 

Gene name
HMGCS2
Definition
3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (EC:2.3.3.10)
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
PPAR signaling pathway
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01123  
HMG-CoA synthase (HMGCS) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    3158 (HMGCS2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    3158 (HMGCS2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3158 (HMGCS2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3158 (HMGCS2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    3158 (HMGCS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     3158 (HMGCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13-p12
AA seq 466 aa AA seqDB search
MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWK
QAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLK
LEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQEL
AGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTE
IMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtctgttgactccagtgaagcgcattctgcaactgacaagagcggtgcaggaa
acctccctcacacctgctcgcctgctcccagtagcccaccaaaggttttctacagcctct
gctgtccccctggccaaaacagatacttggccaaaggacgtgggcatcctggccctggag
gtctacttcccagcccaatatgtggaccaaactgacctggagaagtataacaatgtggaa
gcaggaaagtatacagtgggcttgggccagacccgtatgggcttctgctcagtccaagag
gacatcaactccctgtgcctgacggtggtgcaacggctgatggagcgcatacagctccca
tgggactctgtgggcaggctggaagtaggcactgagaccatcattgacaagtccaaagct
gtcaaaacagtgctcatggaactcttccaggattcaggcaatactgatattgagggcata
gataccaccaatgcctgctacggtggtactgcctccctcttcaatgctgccaactggatg
gagtccagttcctgggatgggctgaggggaacccatatggagaatgtgtatgacttctac
aaaccaaatttggcctcggagtacccaatagtggatgggaagctttccatccagtgctac
ttgcgggccttggatcgatgttacacatcataccgtaaaaaaatccagaatcagtggaag
caagctggcagcgatcgacccttcacccttgacgatttacagtacatgatctttcataca
cccttttgcaagatggtccagaagtctctggctcgcctgatgttcaatgacttcctgtca
gccagcagtgacacacaaaccagcttatataaggggctggaggctttcggggggctaaag
ctggaagacacctacaccaacaaggacctggataaagcacttctaaaggcctctcaggac
atgttcgacaagaaaaccaaggcttccctttacctctccactcacaatgggaacatgtac
acctcatccctgtacgggtgcctggcctcgcttctgtcccaccactctgcccaagaactg
gctggctccaggattggtgccttctcttatggctctggtttagcagcaagtttcttttca
tttcgagtatcccaggatgctgctccaggctctcccctggacaagttggtgtccagcaca
tcagacctgccaaaacgcctagcctcccgaaagtgtgtgtctcctgaggagttcacagaa
ataatgaaccaaagagagcaattctaccataaggtgaatttctccccacctggtgacaca
aacagccttttcccaggtacttggtacctggagcgagtggacgagcagcatcgccgaaag
tatgcccggcgtcccgtctaa

DBGET integrated database retrieval system