KEGG   Homo sapiens (human): 316Help
Entry
316               CDS       T01001                                 

Gene name
AOX1, AO, AOH1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Disease
H00192  
Xanthinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    316 (AOX1)
   00350 Tyrosine metabolism
    316 (AOX1)
   00380 Tryptophan metabolism
    316 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    316 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    316 (AOX1)
   00830 Retinol metabolism
    316 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    316 (AOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     316 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33
AA seq 1338 aa AA seqDB search
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESALEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESINLSAVG
YFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatttgaggaagaagcttcgactcacaggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatacaac
cccatcaccaagaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggattgccaagtgtcatggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacacgctgctcaggaaccacccagagcccactctggatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagtcgcaaaggaccagggtgtttggcagtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggctcctgttatcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccatgca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagatgtaccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaatgagcaattcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcgctagcgata
gtcaattcaggaatgagagtcttttttggagaaggggatggcattattagagagttatgc
atctcatatggaggcgttggtccagccaccatctgtgccaagaattcctgccagaaactc
attggaaggcactggaacgaacagatgctggatatagcctgcaggcttattctgaatgaa
gtctcccttttgggctcggcgccaggtgggaaagtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggatccagtt
cactatcctagccttgcagacaagtatgaaagtgctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagaatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctgtctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctctggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagaacatcttagtgacgtcaactccttctgcttttttactgaagctgag
aaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgctgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtgaagattgtctatcaagacttg
gagccgctgatactaacaattgaggaaagtatacaacacaactcctccttcaagccagaa
aggaaactggaatatggaaatgttgacgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtc
gttcccaagggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacattgttgcctcaaccttgaagctcccagctaacaaggtcatgtgccatgta
aggcgtgttggtggagcgtttggagggaaggtgttaaaaaccggaatcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aacgatggcagaatcttggccctggacatggagcattacagcaatgcaggcgcctccttg
gatgaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaatctccgctgccggggttgggcatgcagaaccaaccttccatccaacacagctttt
cgtgggtttggctttcctcaggcagcgctgatcaccgaatcttgtatcacggaagttgca
gccaaatgtggactatcccctgagaaggtgcgaatcataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctaatccagtgttggagagaatgt
atggccatgtcttcctactccttgaggaaagttgctgtggaaaagttcaatgcagagaat
tattggaagaagaaaggactggccatggtccccctgaagtttcctgttggccttggctca
cgtgctgctggtcaggctgctgccttggttcacatttatcttgatggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaagaatgccaatgtcgaatgtccacctgcgtggaacaagcacagaaactgtc
cctaatgcaaatatctctggaggttctgtggtggcagatctcaacggtttggcagtaaag
gatgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcattaacctttcagctgttgga
tacttcagaggttatgagtcagacatgaactgggagaaaggcgaaggccagcccttcgaa
tactttgtttatggagctgcctgttccgaggttgaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagccattgac
ataggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggcattctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacggagttgcacattgctttgttgcctccttctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgacgcagtgagtgcagcacgacaggagagaggcctgcatggacccttg
acccttaatagtccactgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacctggatcctacgttccttggaatgtacccatctga

DBGET integrated database retrieval system