KEGG   Homo sapiens (human): 316Help
Entry
316               CDS       T01001                                 

Gene name
AOX1, AO, AOH1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Disease
H00192  
Xanthinuria
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hsa00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33
AA seq 1338 aa AA seqDB search
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESALEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESINLSAVG
YFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatttgaggaagaagcttcgactcacaggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatacaac
cccatcaccaagaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggattgccaagtgtcatggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacacgctgctcaggaaccacccagagcccactctggatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagtcgcaaaggaccagggtgtttggcagtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggctcctgttatcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccatgca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagatgtaccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaatgagcaattcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcgctagcgata
gtcaattcaggaatgagagtcttttttggagaaggggatggcattattagagagttatgc
atctcatatggaggcgttggtccagccaccatctgtgccaagaattcctgccagaaactc
attggaaggcactggaacgaacagatgctggatatagcctgcaggcttattctgaatgaa
gtctcccttttgggctcggcgccaggtgggaaagtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggatccagtt
cactatcctagccttgcagacaagtatgaaagtgctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagaatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctgtctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctctggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagaacatcttagtgacgtcaactccttctgcttttttactgaagctgag
aaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgctgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtgaagattgtctatcaagacttg
gagccgctgatactaacaattgaggaaagtatacaacacaactcctccttcaagccagaa
aggaaactggaatatggaaatgttgacgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtc
gttcccaagggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacattgttgcctcaaccttgaagctcccagctaacaaggtcatgtgccatgta
aggcgtgttggtggagcgtttggagggaaggtgttaaaaaccggaatcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aacgatggcagaatcttggccctggacatggagcattacagcaatgcaggcgcctccttg
gatgaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaatctccgctgccggggttgggcatgcagaaccaaccttccatccaacacagctttt
cgtgggtttggctttcctcaggcagcgctgatcaccgaatcttgtatcacggaagttgca
gccaaatgtggactatcccctgagaaggtgcgaatcataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctaatccagtgttggagagaatgt
atggccatgtcttcctactccttgaggaaagttgctgtggaaaagttcaatgcagagaat
tattggaagaagaaaggactggccatggtccccctgaagtttcctgttggccttggctca
cgtgctgctggtcaggctgctgccttggttcacatttatcttgatggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaagaatgccaatgtcgaatgtccacctgcgtggaacaagcacagaaactgtc
cctaatgcaaatatctctggaggttctgtggtggcagatctcaacggtttggcagtaaag
gatgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcattaacctttcagctgttgga
tacttcagaggttatgagtcagacatgaactgggagaaaggcgaaggccagcccttcgaa
tactttgtttatggagctgcctgttccgaggttgaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagccattgac
ataggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggcattctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacggagttgcacattgctttgttgcctccttctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgacgcagtgagtgcagcacgacaggagagaggcctgcatggacccttg
acccttaatagtccactgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacctggatcctacgttccttggaatgtacccatctga

DBGET integrated database retrieval system