KEGG   Homo sapiens (human): 3164Help
Entry
3164              CDS       T01001                                 

Gene name
NR4A1, GFRP1, HMR, N10, NAK-1, NGFIB, NP10, NUR77, TR3
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  
nuclear receptor subfamily 4 group A member 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3164 (NR4A1)
   04151 PI3K-Akt signaling pathway
    3164 (NR4A1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    3164 (NR4A1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    3164 (NR4A1)
Nuclear receptors [BR:hsa03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   3164 (NR4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 598 aa AA seqDB search
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL
EGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccgagtccgggaccccgtgaccac
ctggcaagcgaccccctgacccctgagttcatcaagcccaccatggacctggccagcccc
gaggcagcccccgctgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggagagtttgacaccttcctctaccagctgccaggaacagtccagccatgctcctca
gcctcctcctcggcctcctccacatcctcgtcctcagccacctcccctgcctctgcctcc
ttcaagttcgaggacttccaggtgtacggctgctaccccggccccctgagcggcccagtg
gatgaggccctgtcctccagtggctctgactactatggcagcccctgctcggccccgtcg
ccctccacgcccagcttccagccgccccagctctctccctgggatggctccttcggccac
ttctcgcccagccagacttacgaaggcctgcgggcatggacagagcagctgcccaaagcc
tctgggcccccacagcctccagccttcttttccttcagtcctcccaccggccccagcccc
agcctggcccagagccccctgaagttgttcccctcacaggccacccaccagctgggggag
ggagagagctattccatgcctacggccttcccaggtttggcacccacttctccacacctt
gagggctcggggatactggatacacccgtgacctcaaccaaggcccggagcggggcccca
ggtggaagtgaaggccgctgtgctgtgtgtggggacaacgcttcatgccagcattatggt
gtccgcacatgtgagggctgcaagggcttcttcaagcgcacagtgcagaaaaacgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggcggtgggcatggtgaaggaagttgtccgaacagac
agcctgaaggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcc
cctgccaatctcctcacttccctggtccgtgcacacctggactcagggcccagcactgcc
aaactggactactccaagttccaggagctggtgctgccccactttgggaaggaagatgct
ggggatgtacagcagttctacgacctgctctccggttctctggaggtcatccgcaagtgg
gcggagaagatccctggctttgctgagctgtcaccggctgaccaggacctgttgctggag
tcggccttcctggagctcttcatcctccgcctggcgtacaggtctaagccaggcgagggc
aagctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgtggcttcggg
gactggattgacagtatcctggccttctcaaggtccctgcacagcttgcttgtcgatgtc
cctgccttcgcctgcctctctgcccttgtcctcatcaccgaccggcatgggctgcaggag
ccgcggcgggtggaggagctgcagaaccgcatcgccagctgcctgaaggagcacgtggca
gctgtggcgggcgagccccagccagccagctgcctgtcacgtctgttgggcaaactgccc
gagctgcggaccctgtgcacccagggcctgcagcgcatcttctacctcaagctggaggac
ttggtgccccctccacccatcattgacaagatcttcatggacacgctgcccttctga

DBGET integrated database retrieval system