KEGG   Homo sapiens (human): 3164Help
Entry
3164              CDS       T01001                                 

Gene name
NR4A1, GFRP1, HMR, N10, NAK-1, NGFIB, NP10, NUR77, TR3
Definition
nuclear receptor subfamily 4, group A, member 1
Orthology
K04465  
nuclear receptor subfamily 4 group A member 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 611 aa AA seqDB search
MWLAKACWSIQSEMPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAP
TALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQ
VYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTY
EGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMP
TAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGC
KGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRG
RLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFY
DLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSG
LVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEEL
QNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPI
IDKIFMDTLPF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtggttggccaaggcctgttggtccatccagagtgagatgccctgtatccaagcccaa
tatgggacaccagcaccgagtccgggaccccgtgaccacctggcaagcgaccccctgacc
cctgagttcatcaagcccaccatggacctggccagccccgaggcagcccccgctgccccc
actgccctgcccagcttcagcaccttcatggacggctacacaggagagtttgacaccttc
ctctaccagctgccaggaacagtccagccatgctcctcagcctcctcctcggcctcctcc
acatcctcgtcctcagccacctcccctgcctctgcctccttcaagttcgaggacttccag
gtgtacggctgctaccccggccccctgagcggcccagtggatgaggccctgtcctccagt
ggctctgactactatggcagcccctgctcggccccgtcgccctccacgcccagcttccag
ccgccccagctctctccctgggatggctccttcggccacttctcgcccagccagacttac
gaaggcctgcgggcatggacagagcagctgcccaaagcctctgggcccccacagcctcca
gccttcttttccttcagtcctcccaccggccccagccccagcctggcccagagccccctg
aagttgttcccctcacaggccacccaccagctgggggagggagagagctattccatgcct
acggccttcccaggtttggcacccacttctccacaccttgagggctcggggatactggat
acacccgtgacctcaaccaaggcccggagcggggccccaggtggaagtgaaggccgctgt
gctgtgtgtggggacaacgcttcatgccagcattatggtgtccgcacatgtgagggctgc
aagggcttcttcaagcgcacagtgcagaaaaacgccaagtacatctgcctggctaacaag
gactgccctgtggacaagaggcggcgaaaccgctgccagttctgccgcttccagaagtgc
ctggcggtgggcatggtgaaggaagttgtccgaacagacagcctgaaggggcggcggggc
cggctaccttcaaaacccaagcagcccccagatgcctcccctgccaatctcctcacttcc
ctggtccgtgcacacctggactcagggcccagcactgccaaactggactactccaagttc
caggagctggtgctgccccactttgggaaggaagatgctggggatgtacagcagttctac
gacctgctctccggttctctggaggtcatccgcaagtgggcggagaagatccctggcttt
gctgagctgtcaccggctgaccaggacctgttgctggagtcggccttcctggagctcttc
atcctccgcctggcgtacaggtctaagccaggcgagggcaagctcatcttctgctcaggc
ctggtgctacaccggctgcagtgtgcccgtggcttcggggactggattgacagtatcctg
gccttctcaaggtccctgcacagcttgcttgtcgatgtccctgccttcgcctgcctctct
gcccttgtcctcatcaccgaccggcatgggctgcaggagccgcggcgggtggaggagctg
cagaaccgcatcgccagctgcctgaaggagcacgtggcagctgtggcgggcgagccccag
ccagccagctgcctgtcacgtctgttgggcaaactgcccgagctgcggaccctgtgcacc
cagggcctgcagcgcatcttctacctcaagctggaggacttggtgccccctccacccatc
attgacaagatcttcatggacacgctgcccttctga

DBGET integrated database retrieval system