KEGG   Homo sapiens (human): 317Help
Entry
317               CDS       T01001                                 

Gene name
APAF1, APAF-1, CED4
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington's disease
hsa05134  Legionellosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Module
hsa_M00685  Apoptotic machinery
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    317 (APAF1)
   04215 Apoptosis - multiple species
    317 (APAF1)
   04115 p53 signaling pathway
    317 (APAF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    317 (APAF1)
   05222 Small cell lung cancer
    317 (APAF1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    317 (APAF1)
   05012 Parkinson's disease
    317 (APAF1)
   05014 Amyotrophic lateral sclerosis (ALS)
    317 (APAF1)
   05016 Huntington's disease
    317 (APAF1)
  Infectious diseases
   05134 Legionellosis
    317 (APAF1)
   05152 Tuberculosis
    317 (APAF1)
   05161 Hepatitis B
    317 (APAF1)
  Drug resistance
   01524 Platinum drug resistance
    317 (APAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NB-ARC WD40 ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 AAA_16 Utp8 NACHT AAA_22 Cactin_mid AAA_18
Motif
Other DBs
NCBI-GeneID: 317
NCBI-ProteinID: NP_863651
OMIM: 602233
HGNC: 576
Ensembl: ENSG00000120868
Vega: OTTHUMG00000170214
Pharos: O14727(Tbio)
UniProt: O14727
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 1248 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctgattaaaatgata
cttaaaaaagataatgattcctacgtatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcgtatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgtcacaaggaagaagctggtgaatgcaattcagcagaagctc
tccaaattgaaaggtgaaccaggatgggtcaccatacatggaatggcaggctgtgggaag
tctgtattagctgcagaagctgttagagatcattcccttttagaaggttgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagacaaatctgggcttctgatgaaactgcag
aatctttgcacacggttggatcaggatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgcttcgcaaacacccaaggtctctcttg
atcttggatgatgtttgggactcttgggtgttgaaagcttttgacagtcagtgtcagatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgtagtc
cctgtggagagttccttaggaaaggaaaaaggacttgaaattttatccctttttgttaat
atgaagaaggcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcaaacagcttcagaataagcagtttaagagaataaggaaatcttcgtcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatccttcagaaggacgttaaggtgcctacaaaggtgtta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattctgtgatcggaatggaaagtcgtttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggatctacataagaagata
atcactcagtttcagagatatcaccagccgcatactctttcaccagatcaggaagactgt
atgtattggtacaactttctggcctatcacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcagtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgagccggaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaatgctttacctggaatggataaacaaa
aaaaacatcacgaatctttcccgcttagttgtccgcccccacacagatgctgtttaccat
gcctgcttttctgaggatggtcagagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaggatgaagtg
ctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattctatgactggggaactagtacacacctatgatgagcactcagag
caagtcaattgctgccatttcaccaacagtagtcatcatcttctcttagccactgggtca
agtgactgcttcctcaaactttgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcatacaaattcagtcaatcactgcagattttcaccagatgataagcttttggctagt
tgttcagctgatggaaccttaaagctttgggatgcgacatcagcaaatgagaggaaaagc
attaatgtgaaacagttcttcctaaatttggaggaccctcaagaggatatggaagtgata
gtgaagtgttgttcgtggtctgctgatggtgcaaggataatggtggcagcaaaaaataaa
atctttctttttgacattcatactagtggcctattgggagaaatccacacgggccatcac
agcaccatccagtactgtgacttctccccacaaaaccatttggcagtggttgctttgtcc
cagtactgtgtagagttgtggaatacagactcacgttcaaaggtggctgattgcagagga
catttaagttgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtaagaactctgctgta
atgttaaagcaagaagtagatgttgtgtttcaagaaaatgaagtgatggtccttgcagtt
gaccatataagacgtctgcaactcattaatggaagaacaggtcagattgattatctgact
gaagctcaagttagctgctgttgcttaagtccacatcttcagtacattgcatttggagat
gaaaatggagccattgagattttagaacttgtaaacaatagaatcttccagtccaggttt
cagcacaagaaaactgtatggcacatccagttcacagccgatgagaagactcttatttca
agttctgatgatgctgaaattcaggtatggaattggcaattggacaaatgtatctttcta
cgaggccatcaggaaacagtgaaagactttagactcttgaaaaattcaagactgctttct
tggtcatttgatggaacagtgaaggtatggaatattattactggaaataaagaaaaagac
tttgtctgtcaccagggtacagtactttcttgtgacatttctcacgatgctaccaagttt
tcatctacctctgctgacaagactgcaaagatctggagttttgatctccttttgccactt
catgaattgaggggccacaacggctgtgtgcgctgctctgccttctctgtggacagtacc
ctgctggcaacgggagatgacaatggagaaatcaggatatggaatgtctcaaacggtgag
cttcttcatttgtgtgctccgctttcagaagaaggagctgctacccatggaggctgggtg
actgacctttgcttttctccagatggcaaaatgcttatctctgctggaggatatattaag
tggtggaacgttgtcactggggaatcctcacagaccttctacacaaatggaaccaatctt
aagaaaatacacgtgtcccctgacttcaaaacatatgtgactgtggataatcttggtatt
ttatatattttacagactttagaataa

DBGET integrated database retrieval system