KEGG   Homo sapiens (human): 317Help
Entry
317               CDS       T01001                                 

Gene name
APAF1, APAF-1, CED4
Definition
apoptotic peptidase activating factor 1
Orthology
K02084  
apoptotic protease-activating factor
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Apoptosis
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Tuberculosis
Hepatitis B
Small cell lung cancer
Class
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23
AA seq 1194 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSVRTVLCEGGVPQRPVVFVTRKK
LVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQD
KSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVL
KAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAH
SIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSIS
VEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNKSLLFCDRNGK
SFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHM
ASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLN
GHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVV
RPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRF
IATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGSSDCFLKLWDLN
QKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLE
DPQEDMEVIVKCCSWSADGARIMVAAKNKIFLWNTDSRSKVADCRGHLSWVHGVMFSPDG
SSFLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTG
QIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTAD
EKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIIT
GNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSA
FSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLIS
AGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctgattaaaatgata
cttaaaaaagataatgattcctacgtatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtgtaagg
acagtcctgtgtgaaggtggagtaccacagaggccagttgtttttgtcacaaggaagaag
ctggtgaatgcaattcagcagaagctctccaaattgaaaggtgaaccaggatgggtcacc
atacatggaatggcaggctgtgggaagtctgtattagctgcagaagctgttagagatcat
tcccttttagaaggttgtttcccagggggagtgcattgggtttcagttgggaaacaagac
aaatctgggcttctgatgaaactgcagaatctttgcacacggttggatcaggatgagagt
ttttcccagaggcttccacttaatattgaagaggctaaagaccgtctccgcattctgatg
cttcgcaaacacccaaggtctctcttgatcttggatgatgtttgggactcttgggtgttg
aaagcttttgacagtcagtgtcagattcttcttacaaccagagacaagagtgttacagat
tcagtaatgggtcctaaatatgtagtccctgtggagagttccttaggaaaggaaaaagga
cttgaaattttatccctttttgttaatatgaagaaggcagatttgccagaacaagctcat
agtattataaaagaatgtaaaggctctccccttgtagtatctttaattggtgcactttta
cgtgattttcccaatcgctgggagtactacctcaaacagcttcagaataagcagtttaag
agaataaggaaatcttcgtcttatgattatgaggctctagatgaagccatgtctataagt
gttgaaatgctcagagaagacatcaaagattattacacagatctttccatccttcagaag
gacgttaaggtgcctacaaaggtgttatgtattctctgggacatggaaactgaagaagtt
gaagacatactgcaggagtttgtaaataagtctcttttattctgtgatcggaatggaaag
tcgtttcgttattatttacatgatcttcaagtagattttcttacagagaagaattgcagc
cagcttcaggatctacataagaagataatcactcagtttcagagatatcaccagccgcat
actctttcaccagatcaggaagactgtatgtattggtacaactttctggcctatcacatg
gccagtgccaagatgcacaaggaactttgtgctttaatgttttccctggattggattaaa
gcaaaaacagaacttgtaggccctgctcatctgattcatgaatttgtggaatacagacat
atactagatgaaaaggattgtgcagtcagtgagaattttcaggagtttttatctttaaat
ggacaccttcttggacgacagccatttcctaatattgtacaactgggtctctgtgagccg
gaaacttcagaagtttatcagcaagctaagctgcaggccaagcaggaggtcgataatgga
atgctttacctggaatggataaacaaaaaaaacatcacgaatctttcccgcttagttgtc
cgcccccacacagatgctgtttaccatgcctgcttttctgaggatggtcagagaatagct
tcttgtggagctgataaaaccttacaggtgttcaaagctgaaacaggagagaaacttcta
gaaatcaaggctcatgaggatgaagtgctttgttgtgcattctctacagatgacagattt
atagcaacctgctcagtggataaaaaagtgaagatttggaattctatgactggggaacta
gtacacacctatgatgagcactcagagcaagtcaattgctgccatttcaccaacagtagt
catcatcttctcttagccactgggtcaagtgactgcttcctcaaactttgggatttgaat
caaaaagaatgtcgaaataccatgtttggtcatacaaattcagtcaatcactgcagattt
tcaccagatgataagcttttggctagttgttcagctgatggaaccttaaagctttgggat
gcgacatcagcaaatgagaggaaaagcattaatgtgaaacagttcttcctaaatttggag
gaccctcaagaggatatggaagtgatagtgaagtgttgttcgtggtctgctgatggtgca
aggataatggtggcagcaaaaaataaaatctttttgtggaatacagactcacgttcaaag
gtggctgattgcagaggacatttaagttgggttcatggtgtgatgttttctcctgatgga
tcatcatttttgacatcttctgatgaccagacaatcaggctctgggagacaaagaaagta
tgtaagaactctgctgtaatgttaaagcaagaagtagatgttgtgtttcaagaaaatgaa
gtgatggtccttgcagttgaccatataagacgtctgcaactcattaatggaagaacaggt
cagattgattatctgactgaagctcaagttagctgctgttgcttaagtccacatcttcag
tacattgcatttggagatgaaaatggagccattgagattttagaacttgtaaacaataga
atcttccagtccaggtttcagcacaagaaaactgtatggcacatccagttcacagccgat
gagaagactcttatttcaagttctgatgatgctgaaattcaggtatggaattggcaattg
gacaaatgtatctttctacgaggccatcaggaaacagtgaaagactttagactcttgaaa
aattcaagactgctttcttggtcatttgatggaacagtgaaggtatggaatattattact
ggaaataaagaaaaagactttgtctgtcaccagggtacagtactttcttgtgacatttct
cacgatgctaccaagttttcatctacctctgctgacaagactgcaaagatctggagtttt
gatctccttttgccacttcatgaattgaggggccacaacggctgtgtgcgctgctctgcc
ttctctgtggacagtaccctgctggcaacgggagatgacaatggagaaatcaggatatgg
aatgtctcaaacggtgagcttcttcatttgtgtgctccgctttcagaagaaggagctgct
acccatggaggctgggtgactgacctttgcttttctccagatggcaaaatgcttatctct
gctggaggatatattaagtggtggaacgttgtcactggggaatcctcacagaccttctac
acaaatggaaccaatcttaagaaaatacacgtgtcccctgacttcaaaacatatgtgact
gtggataatcttggtattttatatattttacagactttagaataa

DBGET integrated database retrieval system