KEGG   Homo sapiens (human): 317772Help
Entry
317772            CDS       T01001                                 

Gene name
HIST2H2AB, H2AB
Definition
(RefSeq) histone cluster 2 H2A family member b
  KO
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Necroptosis
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    317772 (HIST2H2AB)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    317772 (HIST2H2AB)
  Substance dependence
   05034 Alcoholism
    317772 (HIST2H2AB)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    317772 (HIST2H2AB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   317772 (HIST2H2AB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8IUE6(Tdark)
UniProt: 
Position
1q21.2
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHKPGKNK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacgcggaaagcagggaggcaaggcccgcgctaaggccaagtcgcgctcgtcc
cgcgctggtctccagttcccggtggggcgagtgcaccgcttgctgcgcaaaggcaactac
gcggagcgggtcggggcaggcgccccggtgtacctggcggcggtcctcgagtacctgacc
gcggaaattctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgccatctgcaactagccgtgaggaatgacgaagagctcaacaagttactcgggggt
gtcaccattgcccagggcggcgtcttgcccaatatccaggctgtcctgttgcccaagaaa
acggagagtcacaagcctggcaagaacaagtaa

DBGET integrated database retrieval system