KEGG   Homo sapiens (human): 325Help
Entry
325               CDS       T01001                                 

Gene name
APCS, HEL-S-92n, PTX2, SAP
Definition
(RefSeq) amyloid P component, serum
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21-q23
AA seq 223 aa AA seqDB search
MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESS
SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD
SVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgctgctttggatctctgtcctcaccagcctcctggaagcctttgctcac
acagacctcagtgggaaggtgtttgtatttcctagagaatctgttactgatcatgtaaac
ttgatcacaccgctggagaagcctctacagaactttaccttgtgttttcgagcctatagt
gatctctctcgtgcctacagcctcttctcctacaatacccaaggcagggataatgagcta
ctagtttataaagaaagagttggagagtatagtctatacattggaagacacaaagttaca
tccaaagttatcgaaaagttcccggctccagtgcacatctgtgtgagctgggagtcctca
tcaggtattgctgaattttggatcaatgggacacctttggtgaaaaagggtctgcgacag
ggttactttgtagaagctcagcccaagattgtcctggggcaggaacaggattcctatggg
ggcaagtttgataggagccagtcctttgtgggagagattggggatttgtacatgtgggac
tctgtgctgcccccagaaaatatcctgtctgcctatcagggtacccctctccctgccaat
atcctggactggcaggctctgaactatgaaatcagaggatatgtcatcatcaaacccttg
gtgtgggtctga

DBGET integrated database retrieval system