KEGG   Homo sapiens (human): 3269Help
Entry
3269              CDS       T01001                                 

Gene name
HRH1, H1-R, H1R, HH1R, hisH1
Definition
(RefSeq) histamine receptor H1
  KO
K04149  
histamine receptor H1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Drug target
Ketanserin [DG:DG00265]: 
Thonzylamine [DG:DG00381]: 
Mepyramine [DG:DG00382]: 
Tripelennamine [DG:DG00383]: 
Chloropyramine [DG:DG00384]: 
Promethazine [DG:DG00385]: 
Dimetindene [DG:DG00386]: 
Clemastine [DG:DG00387]: 
Bamipine [DG:DG00388]: 
Pheniramine: 
Isothipendyl [DG:DG00389]: 
Diphenhydramine [DG:DG00390]: 
Chlorphenoxamine [DG:DG00391]: 
Dimetotiazine [DG:DG00843]: 
Chlorpromazine [DG:DG00867]: 
Olanzapine [DG:DG00898]: 
Quetiapine [DG:DG00899]: 
Hydroxyzine [DG:DG00912]: 
Opipramol [DG:DG00930]: 
Betahistine [DG:DG01004]: 
Cinnarizine [DG:DG01005]: 
Levocabastine [DG:DG01035]: 
Azelastine [DG:DG01036]: 
Antazoline [DG:DG01037]: 
Olopatadine [DG:DG01039]: 
Bromazine: 
Diphenylpyraline [DG:DG01094]: 
Carbinoxamine [DG:DG01095]: 
Doxylamine [DG:DG01096]: 
Brompheniramine [DG:DG01097]: 
Dexchlorpheniramine [DG:DG01098]: 
Chlorphenamine [DG:DG01099]: 
Dexbrompheniramine: 
Alimemazine [DG:DG01101]: 
Mequitazine: 
Buclizine [DG:DG01104]: 
Cyclizine [DG:DG01105]: 
Meclozine [DG:DG01106]: 
Oxatomide: 
Cetirizine [DG:DG01107]: 
Levocetirizine [DG:DG01108]: 
Cyproheptadine [DG:DG01109]: 
Phenindamine [DG:DG01110]: 
Triprolidine [DG:DG01111]: 
Azatadine [DG:DG01112]: 
Astemizole: 
Terfenadine: 
Loratadine: 
Mebhydrolin [DG:DG01113]: 
Deptropine [DG:DG01114]: 
Ketotifen [DG:DG01115]: 
Acrivastine: 
Ebastine: 
Pimethixene: 
Epinastine [DG:DG01116]: 
Mizolastine: 
Fexofenadine [DG:DG01117]: 
Desloratadine: 
Rupatadine [DG:DG01118]: 
Bilastine: 
Emedastine [DG:DG01144]: 
Alcaftadine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3269 (HRH1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3269 (HRH1)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3269 (HRH1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    3269 (HRH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 487 aa AA seqDB search
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgccgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacttgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattctgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgggagctcatcaataggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
tactgctttccacttgatattgtgcacatgcaggctgcggcagaggggagtagcagggac
tatgtagccgtcaaccggagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acggactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaactgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

DBGET integrated database retrieval system