KEGG   Homo sapiens (human): 3269Help
Entry
3269              CDS       T01001                                 

Gene name
HRH1, H1-R, H1R, HH1R, hisH1
Definition
(RefSeq) histamine receptor H1
  KO
K04149  
histamine receptor H1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Drug target
Acrivastine: 
Alcaftadine: 
Alimemazine (DG01101): 
Antazoline (DG01037): 
Astemizole: 
Azatadine (DG01112): 
Azelastine (DG01036): 
Bamipine (DG00388): 
Bepotastine (DG01327): 
Betahistine (DG01004): 
Bilastine: 
Bromazine: 
Brompheniramine (DG01097): 
Buclizine (DG01104): 
Carbinoxamine (DG01095): 
Cetirizine (DG01107): 
Chloropyramine (DG00384): 
Chlorphenamine (DG01099): 
Chlorphenoxamine (DG00391): 
Chlorpromazine (DG00867): 
Cinnarizine (DG01005): 
Clemastine (DG00387): 
Cyclizine (DG01105): 
Cyproheptadine (DG01109): 
Deptropine (DG01114): 
Desloratadine: 
Dexbrompheniramine: 
Dexchlorpheniramine (DG01098): 
Dimenhydrinate: 
Dimetindene (DG00386): 
Dimetotiazine (DG00843): 
Dioxopromethazine hydrochloride: 
Diphenhydramine (DG00390): 
Diphenylpyraline (DG01094): 
Doxylamine (DG01096): 
Ebastine: 
Emedastine (DG01144): 
Epinastine (DG01116): 
Fexofenadine (DG01117): 
Histamine: 
Homochlorcyclizine (DG01328): 
Hydroxyzine (DG00912): 
Icotidine: 
Isothipendyl (DG00389): 
Ketanserin (DG00265): 
Ketotifen (DG01115): 
Latrepirdine (DG01379): 
Levocabastine (DG01035): 
Levocetirizine (DG01108): 
Loratadine: 
Mebhydrolin (DG01113): 
Meclozine (DG01106): 
Mepyramine (DG00382): 
Mequitazine: 
Mizolastine: 
Noberastine: 
Olanzapine (DG00898): 
Olopatadine (DG01039): 
Opipramol (DG00930): 
Oxatomide: 
Phenindamine (DG01110): 
Pheniramine: 
Pimethixene: 
Promethazine (DG00385): 
Quetiapine (DG00899): 
Rocastine hydrochloride: 
Rupatadine (DG01118): 
Tazifylline hydrochloride: 
Tecastemizole: 
Temelastine: 
Terfenadine: 
Thonzylamine (DG00381): 
Tripelennamine (DG00383): 
Triprolidine (DG01111): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3269 (HRH1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3269 (HRH1)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3269 (HRH1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    3269 (HRH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 487 aa AA seqDB search
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgccgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacttgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattctgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgggagctcatcaataggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
tactgctttccacttgatattgtgcacatgcaggctgcggcagaggggagtagcagggac
tatgtagccgtcaaccggagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acggactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaactgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

DBGET integrated database retrieval system