KEGG   Homo sapiens (human): 3269Help
Entry
3269              CDS       T01001                                 

Gene name
HRH1, H1-R, hisH1
Definition
histamine receptor H1
Orthology
K04149  
histamine receptor H1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Drug target
Ketanserin: 
Thonzylamine: 
Mepyramine: 
Tripelennamine: 
Chloropyramine: 
Promethazine: 
Dimetindene: 
Clemastine: 
Bamipine: 
Isothipendyl: 
Diphenhydramine: 
Chlorphenoxamine: 
Dimetotiazine: 
Chlorpromazine: 
Olanzapine: 
Quetiapine: 
Hydroxyzine: 
Opipramol: 
Betahistine: 
Cinnarizine: 
Levocabastine: 
Azelastine: 
Antazoline: 
Olopatadine: 
Bromazine: 
Diphenylpyraline: 
Carbinoxamine: 
Doxylamine: 
Brompheniramine: 
Dexchlorpheniramine: 
Chlorphenamine: 
Pheniramine: 
Dexbrompheniramine: 
Alimemazine: 
Mequitazine: 
Cyclizine: 
Meclozine: 
Oxatomide: 
Cetirizine: 
Levocetirizine: 
Cyproheptadine: 
Phenindamine: 
Triprolidine: 
Azatadine: 
Astemizole: 
Terfenadine: 
Loratadine: 
Ketotifen: 
Acrivastine: 
Ebastine: 
Pimethixene: 
Epinastine: 
Mizolastine: 
Fexofenadine: 
Desloratadine: 
Rupatadine: 
Bilastine: 
Emedastine: 
Alcaftadine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 487 aa AA seqDB search
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgccgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacttgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattctgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgggagctcatcaataggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
tactgctttccacttgatattgtgcacatgcaggctgcggcagaggggagtagcagggac
tatgtagccgtcaaccggagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acggactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaactgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

DBGET integrated database retrieval system