KEGG   Homo sapiens (human): 3274Help
Entry
3274              CDS       T01001                                 

Gene name
HRH2, H2R
Definition
histamine receptor H2
Orthology
K04150  
histamine receptor H2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Drug target
Cimetidine: 
Ranitidine: 
Famotidine: 
Nizatidine: 
Niperotidine: 
Roxatidine: 
Ranitidine bismuth citrate: 
Lafutidine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.2
AA seq 397 aa AA seqDB search
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRP
WLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaatggcacagcctcttccttttgcctggactctaccgcatgcaagatcacc
atcaccgtggtccttgcggtcctcatcctcatcaccgttgctggcaatgtggtcgtctgt
ctggccgtgggcttgaaccgccggctccgcaacctgaccaattgtttcatcgtgtccttg
gctatcactgacctgctcctcggcctcctggtgctgcccttctctgccatctaccagctg
tcctgcaagtggagctttggcaaggtcttctgcaatatctacaccagcctggatgtgatg
ctctgcacagcctccattcttaacctcttcatgatcagcctcgaccggtactgcgctgtc
atggacccactgcggtaccctgtgctggtcaccccagttcgggtcgccatctctctggtc
ttaatttgggtcatctccattaccctgtcctttctgtctatccacctggggtggaacagc
aggaacgagaccagcaagggcaatcataccacctctaagtgcaaagtccaggtcaatgaa
gtgtacgggctggtggatgggctggtcaccttctacctcccgctactgatcatgtgcatc
acctactaccgcatcttcaaggtcgcccgggatcaggccaagaggatcaatcacattagc
tcctggaaggcagccaccatcagggagcacaaagccacagtgacactggccgccgtcatg
ggggccttcatcatctgctggtttccctacttcaccgcgtttgtgtaccgtgggctgaga
ggggatgatgccatcaatgaggtgttagaagccatcgttctgtggctgggctatgccaac
tcagccctgaaccccatcctgtatgctgcgctgaacagagacttccgcaccgggtaccaa
cagctcttctgctgcaggctggccaaccgcaactcccacaaaacttctctgaggtccaac
gcctctcagctgtccaggacccaaagccgagaacccaggcaacaggaagagaaacccctg
aagctccaggtgtggagtgggacagaagtcacggccccccagggagccacagacagacca
tggctttgccttccagaatgctggtctgtggaactgacccattcattcattcatttgttc
attcattcatttgcaaacattcatccaattcccaccacatgccaggaattatga

DBGET integrated database retrieval system