KEGG   Homo sapiens (human): 3280Help
Entry
3280              CDS       T01001                                 

Gene name
HES1, HES-1, HHL, HRY, bHLHb39
Definition
hes family bHLH transcription factor 1
Orthology
K06054  
hairy and enhancer of split 1
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Notch signaling pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    3280 (HES1)
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    3280 (HES1)
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3280 (HES1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    3280 (HES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28-q29
AA seq 280 aa AA seqDB search
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagcct
attatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctctgaagaaagatagctcgcggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggctgcgctg
agcacagacccaagtgtgctggggaagtaccgagccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaataccgaggtgcgcactcggctgctc
ggccacctggccaactgcatgacccagatcaatgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccaccgcccccaccgggacccggcggcccccagcacgcgccg
ttcgcgccgccgccgccactcgtgcccatccccgggggcgcggcgccccctcccggcggc
gccccctgcaagctgggcagccaggctggagaggcggctaaggtgtttggaggcttccag
gtggtaccggctcccgatggccagtttgctttcctcattcccaacggggccttcgcgcac
agcggccctgtcatccccgtctacaccagcaacagcggcacctccgtgggccccaacgca
gtgtcaccttccagcggcccctcgcttacggcggactccatgtggaggccgtggcggaac
tga

DBGET integrated database retrieval system