KEGG   Homo sapiens (human): 329Help
Entry
329               CDS       T01001                                 

Gene name
BIRC2, API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  
baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Hippo signaling pathway
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    329 (BIRC2)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    329 (BIRC2)
   04064 NF-kappa B signaling pathway
    329 (BIRC2)
   04668 TNF signaling pathway
    329 (BIRC2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    329 (BIRC2)
   04215 Apoptosis - multiple species
    329 (BIRC2)
  Cellular commiunity
   04510 Focal adhesion
    329 (BIRC2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    329 (BIRC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    329 (BIRC2)
   05222 Small cell lung cancer
    329 (BIRC2)
  Infectious diseases
   05145 Toxoplasmosis
    329 (BIRC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    329 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22
AA seq 618 aa AA seqDB search
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtg
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
caaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgggatccacctctaagaatacgtctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccct
cttaattctagagcagttgaagacatctcttcatcgaggactaacccctacagttatgca
atgagtactgaagaagccagatttcttacctaccatatgtggccattaacttttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggaggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggccaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcagataccactggagaagaaaatgctgacccaccaattattcattttggacct
ggagaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactataaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaacagaatggctctctttcaacaattgacatgtgtgcttcctatcctggat
aatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcg
gccaacatcttcaaaaactgtctaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
gttgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

DBGET integrated database retrieval system