KEGG   Homo sapiens (human): 329Help
Entry
329               CDS       T01001                                 

Gene name
BIRC2, API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05145  Toxoplasmosis
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    329 (BIRC2)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    329 (BIRC2)
   04064 NF-kappa B signaling pathway
    329 (BIRC2)
   04668 TNF signaling pathway
    329 (BIRC2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    329 (BIRC2)
   04215 Apoptosis - multiple species
    329 (BIRC2)
   04217 Necroptosis
    329 (BIRC2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    329 (BIRC2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    329 (BIRC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    329 (BIRC2)
   05222 Small cell lung cancer
    329 (BIRC2)
  Infectious diseases
   05145 Toxoplasmosis
    329 (BIRC2)
  Drug resistance
   01524 Platinum drug resistance
    329 (BIRC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    329 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C
Motif
Other DBs
NCBI-GeneID: 329
NCBI-ProteinID: NP_001157
OMIM: 601712
HGNC: 590
Ensembl: ENSG00000110330
Vega: OTTHUMG00000167325
Pharos: Q13490(Tchem)
UniProt: Q13490
Structure
PDB: 

Jmol
Position
11q22.2
AA seq 618 aa AA seqDB search
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtg
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
caaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgggatccacctctaagaatacgtctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccct
cttaattctagagcagttgaagacatctcttcatcgaggactaacccctacagttatgca
atgagtactgaagaagccagatttcttacctaccatatgtggccattaacttttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggaggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggccaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcagataccactggagaagaaaatgctgacccaccaattattcattttggacct
ggagaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactataaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaacagaatggctctctttcaacaattgacatgtgtgcttcctatcctggat
aatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcg
gccaacatcttcaaaaactgtctaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
gttgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

DBGET integrated database retrieval system