KEGG   Homo sapiens (human): 330Help
Entry
330               CDS       T01001                                 

Gene name
BIRC3, AIP1, API2, CIAP2, HAIP1, HIAP1, MALT2, MIHC, RNF49, c-IAP2
Definition
baculoviral IAP repeat containing 3
Orthology
K16060  
baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Toxoplasmosis
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    330 (BIRC3)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    330 (BIRC3)
   04668 TNF signaling pathway
    330 (BIRC3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    330 (BIRC3)
  Cell communication
   04510 Focal adhesion
    330 (BIRC3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    330 (BIRC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    330 (BIRC3)
   05202 Transcriptional misregulation in cancers
    330 (BIRC3)
   05222 Small cell lung cancer
    330 (BIRC3)
  Infectious diseases
   05145 Toxoplasmosis
    330 (BIRC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22
AA seq 604 aa AA seqDB search
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagtagaaaacagcatattcttatcaaatttgatgaaaagcgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgtgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaaagaggagac
agtcctactgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tccgttaacaacttggaagctacctctcagcctacttttccttcttcagtaacaaattcc
acacactcattacttccgggtacagaaaacagtggatatttccgtggctcttattcaaac
tctccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataacgaaaatgccagattacttacttttcagacatggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggataat
gctatgtcagaacacctgagacattttcccaaatgcccatttatagaaaatcagcttcaa
gacacttcaagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcgggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggttcaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatccgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatccacatcagacagcccaggagatgaaaatgcagagtcatca
attatccattttgaacctggagaagaccattcagaagatgcaatcatgatgaatactcct
gtgattaatgctgccgtggaaatgggctttagtagaagcctggtaaaacagacagttcag
agaaaaatcctagcaactggagagaattatagactagtcaatgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccggaattattaatgaacaagaacatgat
gttattaaacagaagacacagacgtctttacaagcaagagaactgattgatacgatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgaagctgtg
ttatatgagcatttatttgtgcaacaggacataaaatatattcccacagaagatgtttca
gatctaccagtggaagaacaattgcggagactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgtaggagtacaatcaagggtacagttcgt
acatttctttcatga

DBGET integrated database retrieval system