KEGG   Homo sapiens (human): 3308Help
Entry
3308              CDS       T01001                                 

Gene name
HSPA4, APG-2, HEL-S-5a, HS24/P52, HSPH2, RY, hsp70, hsp70RY
Definition
(RefSeq) heat shock protein family A (Hsp70) member 4
  KO
K09489  
heat shock 70kDa protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    3308 (HSPA4)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3308 (HSPA4)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3308 (HSPA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P34932(Tbio)
UniProt: 
Position
5q31.1
AA seq 840 aa AA seqDB search
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggtgggcatagacctgggcttccagagctgctacgtcgctgtggcccgcgcc
ggcggcatcgagactatcgctaatgagtatagcgaccgctgcacgccggcttgcatttct
tttggtcctaagaatcgttcaattggagcagcagctaaaagccaggtaatttctaatgca
aagaacacagtccaaggatttaaaagattccatggccgagcattctctgatccatttgtg
gaggcagaaaaatctaaccttgcatatgatattgtgcagttgcctacaggattaacaggt
ataaaggtgacatatatggaggaagagcgaaattttaccactgagcaagtgactgccatg
cttttgtccaaactgaaggagacagccgaaagtgttcttaagaagcctgtagttgactgt
gttgtttcggttccttgtttctatactgatgcagaaagacgatcagtgatggatgcaaca
cagattgctggtcttaattgcttgcgattaatgaatgaaaccactgcagttgctcttgca
tatggaatctataagcaggatcttcctgccttagaagagaaaccaagaaatgtagttttt
gtagacatgggccactctgcttatcaagtttctgtatgtgcatttaatagaggaaaactg
aaagttctggccactgcatttgacacgacattgggaggtagaaaatttgatgaagtgtta
gtaaatcacttctgtgaagaatttgggaagaaatacaagctagacattaagtccaaaatc
cgtgcattattacgactctctcaggagtgtgagaaactcaagaaattgatgagtgcaaat
gcttcagatctccctttgagcattgaatgttttatgaatgatgttgatgtatctggaact
atgaatagaggcaaatttctggagatgtgcaatgatctcttagctagagtggagccacca
cttcgtagtgttttggaacaaaccaagttaaagaaagaagatatttatgcagtggagata
gttggtggtgctacacgaatccctgcggtaaaagagaagatcagcaaatttttcggtaaa
gaacttagtacaacattaaatgctgatgaagctgtcactcgaggctgtgcattgcagtgt
gccatcttatcgcctgctttcaaagtcagagaattttctatcactgatgtagtaccatat
ccaatatctctgagatggaattctccagctgaagaagggtcaagtgactgtgaagtcttt
tccaaaaatcatgctgctcctttctctaaagttcttacattttatagaaaggaacctttc
actcttgaggcctactacagctctcctcaggatttgccctatccagatcctgctatagct
cagttttcagttcagaaagtcactcctcagtctgatggctccagttcaaaagtgaaagtc
aaagttcgagtaaatgtccatggcattttcagtgtgtccagtgcatctttagtggaggtt
cacaagtctgaggaaaatgaggagccaatggaaacagatcagaatgcaaaggaggaagag
aagatgcaagtggaccaggaggaaccacatgttgaagagcaacagcagcagacaccagca
gaaaataaggcagagtctgaagaaatggagacctctcaagctggatccaaggataaaaag
atggaccaaccaccccaagccaagaaggcaaaagtgaagaccagtactgtggacctgcca
atcgagaatcagctattatggcagatagacagagagatgctcaacttgtacattgaaaat
gagggtaagatgatcatgcaggataaactggagaaggagcggaatgatgctaagaacgca
gtggaggaatatgtgtatgaaatgagagacaagcttagtggtgaatatgagaagtttgtg
agtgaagatgatcgtaacagttttactttgaaactggaagatactgaaaattggttgtat
gaggatggagaagaccagccaaagcaagtttatgttgataagttggctgaattaaaaaat
ctaggtcaacctattaagatacgtttccaggaatctgaagaacgaccaaaattatttgaa
gaactagggaaacagatccaacagtatatgaaaataatcagctctttcaaaaacaaggag
gaccagtatgatcatttggatgctgctgacatgacaaaggtagaaaaaagcacaaatgaa
gcaatggagtggatgaataacaagctaaatctgcagaacaagcagagtttgaccatggat
ccagttgtcaagtcaaaagagattgaagctaaaattaaggagctgacaagtacttgtagc
cctataatttcaaagcccaaacccaaagtggaacctccaaaagaggaacaaaaaaatgca
gagcagaatggaccagtggatggacaaggagacaacccaggcccccaggctgctgagcag
ggtacagacacagctgtgccttcggattcagacaagaagcttcctgaaatggacattgat
tga

DBGET integrated database retrieval system