KEGG   Homo sapiens (human): 3309Help
Entry
3309              CDS       T01001                                 

Gene name
HSPA5, BIP, GRP78, HEL-S-89n, MIF2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 5
  KO
K09490  
heat shock 70kDa protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Thyroid hormone synthesis
Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    3309 (HSPA5)
   04141 Protein processing in endoplasmic reticulum
    3309 (HSPA5)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3309 (HSPA5)
  Endocrine system
   04918 Thyroid hormone synthesis
    3309 (HSPA5)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    3309 (HSPA5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3309 (HSPA5)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3309 (HSPA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3309 (HSPA5)
  Exosomal proteins of other body fluids (saliva and urine)
   3309 (HSPA5)
  Exosomal proteins of colorectal cancer cells
   3309 (HSPA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.3
AA seq 654 aa AA seqDB search
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctccctggtggccgcgatgctgctgctgctcagcgcggcgcgggccgaggag
gaggacaagaaggaggacgtgggcacggtggtcggcatcgacctggggaccacctactcc
tgcgtcggcgtgttcaagaacggccgcgtggagatcatcgccaacgatcagggcaaccgc
atcacgccgtcctatgtcgccttcactcctgaaggggaacgtctgattggcgatgccgcc
aagaaccagctcacctccaaccccgagaacacggtctttgacgccaagcggctcatcggc
cgcacgtggaatgacccgtctgtgcagcaggacatcaagttcttgccgttcaaggtggtt
gaaaagaaaactaaaccatacattcaagttgatattggaggtgggcaaacaaagacattt
gctcctgaagaaatttctgccatggttctcactaaaatgaaagaaaccgctgaggcttat
ttgggaaagaaggttacccatgcagttgttactgtaccagcctattttaatgatgcccaa
cgccaagcaaccaaagacgctggaactattgctggcctaaatgttatgaggatcatcaac
gagcctacggcagctgctattgcttatggcctggataagagggagggggagaagaacatc
ctggtgtttgacctgggtggcggaaccttcgatgtgtctcttctcaccattgacaatggt
gtcttcgaagttgtggccactaatggagatactcatctgggtggagaagactttgaccag
cgtgtcatggaacacttcatcaaactgtacaaaaagaagacgggcaaagatgtcaggaaa
gacaatagagctgtgcagaaactccggcgcgaggtagaaaaggccaaacgggccctgtct
tctcagcatcaagcaagaattgaaattgagtccttctatgaaggagaagacttttctgag
accctgactcgggccaaatttgaagagctcaacatggatctgttccggtctactatgaag
cccgtccagaaagtgttggaagattctgatttgaagaagtctgatattgatgaaattgtt
cttgttggtggctcgactcgaattccaaagattcagcaactggttaaagagttcttcaat
ggcaaggaaccatcccgtggcataaacccagatgaagctgtagcgtatggtgctgctgtc
caggctggtgtgctctctggtgatcaagatacaggtgacctggtactgcttgatgtatgt
ccccttacacttggtattgaaactgtgggaggtgtcatgaccaaactgattccaaggaac
acagtggtgcctaccaagaagtctcagatcttttctacagcttctgataatcaaccaact
gttacaatcaaggtctatgaaggtgaaagacccctgacaaaagacaatcatcttctgggt
acatttgatctgactggaattcctcctgctcctcgtggggtcccacagattgaagtcacc
tttgagatagatgtgaatggtattcttcgagtgacagctgaagacaagggtacagggaac
aaaaataagatcacaatcaccaatgaccagaatcgcctgacacctgaagaaatcgaaagg
atggttaatgatgctgagaagtttgctgaggaagacaaaaagctcaaggagcgcattgat
actagaaatgagttggaaagctatgcctattctctaaagaatcagattggagataaagaa
aagctgggaggtaaactttcctctgaagataaggagaccatggaaaaagctgtagaagaa
aagattgaatggctggaaagccaccaagatgctgacattgaagacttcaaagctaagaag
aaggaactggaagaaattgttcaaccaattatcagcaaactctatggaagtgcaggccct
cccccaactggtgaagaggatacagcagaaaaagatgagttgtag

DBGET integrated database retrieval system