KEGG   Homo sapiens (human): 3310Help
Entry
3310              CDS       T01001                                 

Gene name
HSPA6
Definition
heat shock 70kDa protein 6 (HSP70B')
Orthology
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3310 (HSPA6)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3310 (HSPA6)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3310 (HSPA6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3310 (HSPA6)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3310 (HSPA6)
  Endocrine system
   04915 Estrogen signaling pathway
    3310 (HSPA6)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3310 (HSPA6)
   05162 Measles
    3310 (HSPA6)
   05164 Influenza A
    3310 (HSPA6)
   05169 Epstein-Barr virus infection
    3310 (HSPA6)
   05145 Toxoplasmosis
    3310 (HSPA6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3310 (HSPA6)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3310 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    3310 (HSPA6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3310 (HSPA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3310 (HSPA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 643 aa AA seqDB search
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagggccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtcggggacgcggccaagagccag
gcggccctgaacccccacaacaccgtgttcgatgccaagcggctgatcgggcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccgggtggtgagcgagggc
ggcaagcccaaggtgcgcgtatgctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggccgaggcgtacctgggccagccc
gtgaagcacgcagtgatcaccgtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgttgcggatcatcaatgagcccacggca
gctgccatcgcctatgggctggaccggcggggcgcgggagagcgcaacgtgctcattttt
gacctgggtgggggcaccttcgatgtgtcggttctctccattgacgctggtgtctttgag
gtgaaagccactgctggagatacccacctgggaggagaggacttcgacaaccggctcgtg
aaccacttcatggaagaattccggcggaagcatgggaaggacctgagcgggaacaagcgt
gccctgcgcaggctgcgcacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagatagactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgcagcaccctggagccggtggag
aaggccctgcgggatgccaagctggacaaggcccagattcatgacgtcgtcctggtgggg
ggctccactcgcatccccaaggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccctgatgaggctgtggcctatggggctgctgtgcaggcggcc
gtgttgatgggggacaaatgtgagaaagtgcaggatctcctgctgctggatgtggctccc
ctgtctctggggctggagacagcaggtggggtgatgaccacgctgatccagaggaacgcc
actatccccaccaagcagacccagactttcaccacctactcggacaaccagcctggggtc
ttcatccaggtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgt
tttgaactcagtggcatccctcctgccccacgtggagtcccccagatagaggtgaccttt
gacattgatgctaatggcatcctgagcgtgacagccactgacaggagcacaggtaaggct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcatgaagccgagcagtacaaggctgaggatgaggcccagagggacagagtggctgcc
aaaaactcgctggaggcccatgtcttccatgtgaaaggttctttgcaagaggaaagcctt
agggacaagattcccgaagaggacaggcgcaaaatgcaagacaagtgtcgggaagtcctt
gcctggctggagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggag
ctggagcaaatctgtcgccccatcttctccaggctctatggggggcctggtgtccctggg
ggcagcagttgtggcactcaagcccgccagggggaccccagcaccggccccatcattgag
gaggttgattga

DBGET integrated database retrieval system