KEGG   Homo sapiens (human): 3310Help
Entry
3310              CDS       T01001                                 

Gene name
HSPA6
Definition
heat shock 70kDa protein 6 (HSP70B')
Orthology
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 643 aa AA seqDB search
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagggccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtcggggacgcggccaagagccag
gcggccctgaacccccacaacaccgtgttcgatgccaagcggctgatcgggcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccgggtggtgagcgagggc
ggcaagcccaaggtgcgcgtatgctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggccgaggcgtacctgggccagccc
gtgaagcacgcagtgatcaccgtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgttgcggatcatcaatgagcccacggca
gctgccatcgcctatgggctggaccggcggggcgcgggagagcgcaacgtgctcattttt
gacctgggtgggggcaccttcgatgtgtcggttctctccattgacgctggtgtctttgag
gtgaaagccactgctggagatacccacctgggaggagaggacttcgacaaccggctcgtg
aaccacttcatggaagaattccggcggaagcatgggaaggacctgagcgggaacaagcgt
gccctgcgcaggctgcgcacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagatagactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgcagcaccctggagccggtggag
aaggccctgcgggatgccaagctggacaaggcccagattcatgacgtcgtcctggtgggg
ggctccactcgcatccccaaggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccctgatgaggctgtggcctatggggctgctgtgcaggcggcc
gtgttgatgggggacaaatgtgagaaagtgcaggatctcctgctgctggatgtggctccc
ctgtctctggggctggagacagcaggtggggtgatgaccacgctgatccagaggaacgcc
actatccccaccaagcagacccagactttcaccacctactcggacaaccagcctggggtc
ttcatccaggtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgt
tttgaactcagtggcatccctcctgccccacgtggagtcccccagatagaggtgaccttt
gacattgatgctaatggcatcctgagcgtgacagccactgacaggagcacaggtaaggct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcatgaagccgagcagtacaaggctgaggatgaggcccagagggacagagtggctgcc
aaaaactcgctggaggcccatgtcttccatgtgaaaggttctttgcaagaggaaagcctt
agggacaagattcccgaagaggacaggcgcaaaatgcaagacaagtgtcgggaagtcctt
gcctggctggagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggag
ctggagcaaatctgtcgccccatcttctccaggctctatggggggcctggtgtccctggg
ggcagcagttgtggcactcaagcccgccagggggaccccagcaccggccccatcattgag
gaggttgattga

DBGET integrated database retrieval system