KEGG   Homo sapiens (human): 3313Help
Entry
3313              CDS       T01001                                 

Gene name
HSPA9, CSA, GRP-75, GRP75, HSPA9B, MOT, MOT2, MTHSP75, PBP74
Definition
heat shock 70kDa protein 9 (mortalin)
Orthology
K04043  
molecular chaperone DnaK
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Tuberculosis
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:hsa03018]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 679 aa AA seqDB search
MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDL
GTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYAT
KRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAEN
YLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVI
AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTK
DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIR
RTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQT
QVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTG
REQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK
DQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASERE
GSGSSGTGEQKEDQKEEKQ
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgataagtgccagccgagctgcagcagcccgtctcgtgggcgccgcagcctcccggggc
cctacggccgcccgccaccaggatagctggaatggccttagtcatgaggcttttagactt
gtttcaaggcgggattatgcatcagaagcaatcaagggagcagttgttggtattgatttg
ggtactaccaactcctgcgtggcagttatggaaggtaaacaagcaaaggtgctggagaat
gccgaaggtgccagaaccaccccttcagttgtggcctttacagcagatggtgagcgactt
gttggaatgccggccaagcgacaggctgtcaccaacccaaacaatacattttatgctacc
aagcgtctcattggccggcgatatgatgatcctgaagtacagaaagacattaaaaatgtt
ccctttaaaattgtccgtgcctccaatggtgatgcctgggttgaggctcatgggaaattg
tattctccgagtcagattggagcatttgtgttgatgaagatgaaagagactgcagaaaat
tacttggggcacacagcaaaaaatgctgtgatcacagtcccagcttatttcaatgactcg
cagagacaggccactaaagatgctggccagatatctggactgaatgtgcttcgggtgatt
aatgagcccacagctgctgctcttgcctatggtctagacaaatcagaagacaaagtcatt
gctgtatatgatttaggtggtggaacttttgatatttctatcctggaaattcagaaagga
gtatttgaggtgaaatccacaaatggggataccttcttaggtggggaagactttgaccag
gccttgctacggcacattgtgaaggagttcaagagagagacaggggttgatttgactaaa
gacaacatggcacttcagagggtacgggaagctgctgaaaaggctaaatgtgaactctcc
tcatctgtgcagactgacatcaatttgccctatcttacaatggattcttctggacccaag
catttgaatatgaagttgacccgtgctcaatttgaagggattgtcactgatctaatcaga
aggactatcgctccatgccaaaaagctatgcaagatgcagaagtcagcaagagtgacata
ggagaagtgattcttgtgggtggcatgactaggatgcccaaggttcagcagactgtacag
gatctttttggcagagccccaagtaaagctgtcaatcctgatgaggctgtggccattgga
gctgccattcagggaggtgtgttggccggcgatgtcacggatgtgctgctccttgatgtc
actcccctgtctctgggtattgaaactctaggaggtgtctttaccaaacttattaatagg
aataccactattccaaccaagaagagccaggtattctctactgccgctgatggtcaaacg
caagtggaaattaaagtgtgtcagggtgaaagagagatggctggagacaacaaactcctt
ggacagtttactttgattggaattccaccagcccctcgtggagttcctcagattgaagtt
acatttgacattgatgccaatgggatagtacatgtttctgctaaagataaaggcacagga
cgtgagcagcagattgtaatccagtcttctggtggattaagcaaagatgatattgaaaat
atggttaaaaatgcagagaaatatgctgaagaagaccggcgaaagaaggaacgagttgaa
gcagttaatatggctgaaggaatcattcacgacacagaaaccaagatggaagaattcaag
gaccaattacctgctgatgagtgcaacaagctgaaagaagagatttccaaaatgagggag
ctcctggctagaaaagacagcgaaacaggagaaaatattagacaggcagcatcctctctt
cagcaggcatcactgaagctgttcgaaatggcatacaaaaagatggcatctgagcgagaa
ggctctggaagttctggcactggggaacaaaaggaagatcaaaaggaggaaaaacagtaa

DBGET integrated database retrieval system