KEGG   Homo sapiens (human): 3315Help
Entry
3315              CDS       T01001                                 

Gene name
HSPB1, CMT2F, HEL-S-102, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Definition
heat shock 27kDa protein 1
Orthology
K04455  
heat shock protein beta-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Amoebiasis
Epstein-Barr virus infection
Disease
H00856  
Distal hereditary motor neuropathies (dHMN)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 205 aa AA seqDB search
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgccgcgtccccttctcgctcctgcggggccccagctgggaccccttccgc
gactggtacccgcatagccgcctcttcgaccaggccttcgggctgccccggctgccggag
gagtggtcgcagtggttaggcggcagcagctggccaggctacgtgcgccccctgcccccc
gccgccatcgagagccccgcagtggccgcgcccgcctacagccgcgcgctcagccggcaa
ctcagcagcggggtctcggagatccggcacactgcggaccgctggcgcgtgtccctggat
gtcaaccacttcgccccggacgagctgacggtcaagaccaaggatggcgtggtggagatc
accggcaagcacgaggagcggcaggacgagcatggctacatctcccggtgcttcacgcgg
aaatacacgctgccccccggtgtggaccccacccaagtttcctcctccctgtcccctgag
ggcacactgaccgtggaggcccccatgcccaagctagccacgcagtccaacgagatcacc
atcccagtcaccttcgagtcgcgggcccagcttgggggcccagaagctgcaaaatccgat
gagactgccgccaagtaa

DBGET integrated database retrieval system