KEGG   Homo sapiens (human): 332Help
Entry
332               CDS       T01001                                 

Gene name
BIRC5, API4, EPR-1
Definition
baculoviral IAP repeat containing 5
Orthology
K08731  
baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Hepatitis B
Pathways in cancer
Colorectal cancer
Drug target
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 137 aa AA seqDB search
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQ
GLFPGATSLPVGPLAMS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatgcaaaggaaaccaacaata
agaagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctg
ccatggattgaggcctctggccggagctgcctggtcccagagtggctgcaccacttccag
ggtttattccctggtgccaccagccttcctgtgggccccttagcaatgtcttag

DBGET integrated database retrieval system