KEGG   Homo sapiens (human): 332Help
Entry
332               CDS       T01001                                 

Gene name
BIRC5, API4, EPR-1
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  
baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Apoptosis
Apoptosis - multiple species
Hippo signaling pathway
Hepatitis B
Pathways in cancer
Colorectal cancer
Drug target
Gataparsen (DG01431): 
Sepantronium bromide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    332 (BIRC5)
   04215 Apoptosis - multiple species
    332 (BIRC5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    332 (BIRC5)
   05210 Colorectal cancer
    332 (BIRC5)
  Infectious diseases
   05161 Hepatitis B
    332 (BIRC5)
  Drug resistance
   01524 Platinum drug resistance
    332 (BIRC5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     332 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    332 (BIRC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 142 aa AA seqDB search
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtccggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttttgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgcc
atggattga

DBGET integrated database retrieval system