KEGG   Homo sapiens (human): 332Help
Entry
332               CDS       T01001                                 

Gene name
BIRC5, API4, EPR-1
Definition
baculoviral IAP repeat containing 5
Orthology
K08731  
baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Hepatitis B
Pathways in cancer
Colorectal cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    332 (BIRC5)
   05210 Colorectal cancer
    332 (BIRC5)
  Infectious diseases
   05161 Hepatitis B
    332 (BIRC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 137 aa AA seqDB search
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQ
GLFPGATSLPVGPLAMS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatgcaaaggaaaccaacaata
agaagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctg
ccatggattgaggcctctggccggagctgcctggtcccagagtggctgcaccacttccag
ggtttattccctggtgccaccagccttcctgtgggccccttagcaatgtcttag

DBGET integrated database retrieval system