KEGG   Homo sapiens (human): 3329Help
Entry
3329              CDS       T01001                                 

Gene name
HSPD1, CPN60, GROEL, HLD4, HSP-60, HSP60, HSP65, HuCHA60, SPG13
Definition
(RefSeq) heat shock protein family D (Hsp60) member 1
  KO
K04077  
chaperonin GroEL
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Type I diabetes mellitus
Legionellosis
Tuberculosis
Disease
H00266  
Hereditary spastic paraplegia (SPG)
H00679  
Hypomyelinating leukodystrophy (HLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    3329 (HSPD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3329 (HSPD1)
  Infectious diseases
   05134 Legionellosis
    3329 (HSPD1)
   05152 Tuberculosis
    3329 (HSPD1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     3329 (HSPD1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   3329 (HSPD1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    3329 (HSPD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3329 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   3329 (HSPD1)
  Exosomal proteins of breast cancer cells
   3329 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   3329 (HSPD1)
  Exosomal proteins of bladder cancer cells
   3329 (HSPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 573 aa AA seqDB search
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggttacccacagtctttcgccagatgagaccggtgtccagggtactggctcct
catctcactcgggcttatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagccgatgctgtggccgttacaatggggccaaagggaaga
acagtgattattgagcagagttggggaagtcccaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgacttaaaagataaatacaaaaacattggagctaaacttgttcaagat
gttgccaataacacaaatgaagaagctggggatggcactaccactgctactgtactggca
cgctctatagccaaggaaggcttcgagaagattagcaaaggtgctaatccagtggaaatc
aggagaggtgtgatgttagctgttgatgctgtaattgctgaacttaaaaagcagtctaaa
cctgtgaccacccctgaagaaattgcacaggttgctacgatttctgcaaacggagacaaa
gaaattggcaatatcatctctgatgcaatgaaaaaagttggaagaaagggtgtcatcaca
gtaaaggatggaaaaacactgaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggctatatttctccatactttattaatacatcaaaaggtcagaaatgtgaattccag
gatgcctatgttctgttgagtgaaaagaaaatttctagtatccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcctttggtcataatcgctgaagatgttgatgga
gaagctctaagtacactcgtcttgaataggctaaaggttggtcttcaggttgtggcagtc
aaggctccagggtttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtgtttggagaagagggattgaccctgaatcttgaagacgttcagcctcat
gacttaggaaaagttggagaggtcattgtgaccaaagacgatgccatgctcttaaaagga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcattgagcagttagatgtc
acaactagtgaatatgaaaaggaaaaactgaatgaacggcttgcaaaactttcagatgga
gtggctgtgctgaaggttggtgggacaagtgatgttgaagtgaatgaaaagaaagacaga
gttacagatgcccttaatgctacaagagctgctgttgaagaaggcattgttttgggaggg
ggttgtgccctccttcgatgcattccagccttggactcattgactccagctaatgaagat
caaaaaattggtatagaaattattaaaagaacactcaaaattccagcaatgaccattgct
aagaatgcaggtgttgaaggatctttgatagttgagaaaattatgcaaagttcctcagaa
gttggttatgatgctatggctggagattttgtgaatatggtggaaaaaggaatcattgac
ccaacaaaggttgtgagaactgctttattggatgctgctggtgtggcctctctgttaact
acagcagaagttgtagtcacagaaattcctaaagaagagaaggaccctggaatgggtgca
atgggtggaatgggaggtggtatgggaggtggcatgttctaa

DBGET integrated database retrieval system