KEGG   Homo sapiens (human): 3337Help
Entry
3337              CDS       T01001                                 

Gene name
DNAJB1, HSPF1, Hdj1, Hsp40, RSPH16B, Sis1
Definition
DnaJ (Hsp40) homolog, subfamily B, member 1
Orthology
K09507  
DnaJ homolog subfamily B member 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3337 (DNAJB1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    3337 (DNAJB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 340 aa AA seqDB search
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagactactaccagacgttgggcctggcccgcggcgcgtcggacgaggagatc
aagcgggcctaccgccgccaggcgctgcgctaccacccggacaagaacaaggagcccggc
gccgaggagaagttcaaggagatcgctgaggcctacgacgtgctcagcgacccgcgcaag
cgcgagatcttcgaccgctacggggaggaaggcctaaaggggagtggccccagtggcggt
agcggcggtggtgccaatggtacctctttcagctacacattccatggagaccctcatgcc
atgtttgctgagttcttcggtggcagaaatccctttgacaccttttttgggcagcggaac
ggggaggaaggcatggacattgatgacccattctctggcttccctatgggcatgggtggc
ttcaccaacgtgaactttggccgctcccgctctgcccaagagcccgcccgaaagaagcaa
gatcccccagtcacccacgaccttcgagtctcccttgaagagatctacagcggctgtacc
aagaagatgaaaatctcccacaagcggctaaaccccgacggaaagagcattcgaaacgaa
gacaaaatattgaccatcgaagtgaagaaggggtggaaagaaggaaccaaaatcactttc
cccaaggaaggagaccagacctccaacaacattccagctgatatcgtctttgttttaaag
gacaagccccacaatatctttaagagagatggctctgatgtcatttatcctgccaggatc
agcctccgggaggctctgtgtggctgcacagtgaacgtccccactctggacggcaggacg
atacccgtcgtattcaaagatgttatcaggcctggcatgcggcgaaaagttcctggagaa
ggcctccccctccccaaaacacccgagaaacgtggggacctcattattgagtttgaagtg
atcttccccgaaaggattccccagacatcaagaaccgtacttgagcaggttcttccaata
tag

DBGET integrated database retrieval system