KEGG   Homo sapiens (human): 3355Help
Entry
3355              CDS       T01001                                 

Gene name
HTR1F, 5-HT-1F, 5-HT1F, 5HT6, HTR1EL, MR77
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Lasmiditan (DG01332): D10338 D10424
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3355 (HTR1F)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3355 (HTR1F)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3355 (HTR1F)
  Sensory system
   04742 Taste transduction
    3355 (HTR1F)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3355 (HTR1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx Glycoprotein_G
Motif
Other DBs
NCBI-GeneID: 3355
NCBI-ProteinID: NP_000857
OMIM: 182134
HGNC: 5292
Ensembl: ENSG00000179097
Vega: OTTHUMG00000159008
Pharos: P30939(Tchem)
UniProt: P30939
Position
3p11.2-p11.1
AA seq 366 aa AA seqDB search
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttaaattcatctgatcaaaacttgacctcagaggaactgttaaacagaatg
ccatccaaaattctggtgtccctcactctgtctgggctggcactgatgacaacaactatc
aactcccttgtgatcgctgcaattattgtgacccggaagctgcaccatccagccaattat
ttaatttgttcccttgcagtcacagattttcttgtggctgtcctggtgatgcccttcagc
attgtgtatattgtgagagagagctggattatggggcaagtggtctgtgacatttggctg
agtgttgacattacctgctgcacgtgctccatcttgcatctctcagctatagctttggat
cggtatcgagcaatcacagatgctgttgagtatgccaggaaaaggactccaaagcatgct
ggcattatgattacaatagtttggattatatctgtttttatctctatgcctcctctattc
tggaggcaccaaggaactagcagagatgatgaatgcatcatcaagcacgaccacattgtt
tccaccatttactcaacatttggagctttctacatcccactggcattgattttgatcctt
tactacaaaatatatagagcagcaaagacattataccacaagagacaagcaagtaggatt
gcaaaggaggaggtgaatggccaagtccttttggagagtggtgagaaaagcactaaatca
gtttccacatcctatgtactagaaaagtctttatctgacccatcaacagactttgataaa
attcatagcacagtgagaagtctcaggtctgaattcaagcatgagaaatcttggagaagg
caaaagatctcaggtacaagagaacggaaagcagccactaccctgggattaatcttgggt
gcatttgtaatatgttggcttcctttttttgtaaaagaattagttgttaatgtctgtgac
aaatgtaaaatttctgaagaaatgtccaattttttggcatggcttgggtatctcaattcc
cttataaatccactgatttacacaatctttaatgaagacttcaagaaagcattccaaaag
cttgtgcgatgtcgatgttag

DBGET integrated database retrieval system