KEGG   Homo sapiens (human): 3355Help
Entry
3355              CDS       T01001                                 

Gene name
HTR1F, 5-HT-1F, 5-HT1F, 5HT6, HTR1EL, MR77
Definition
5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled
Orthology
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Methylergometrine: 
Ergometrine: 
Metergoline: 
Naratriptan: 
Pizotifen: 
Asenapine: 
Mianserin: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p12
AA seq 366 aa AA seqDB search
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttaaattcatctgatcaaaacttgacctcagaggaactgttaaacagaatg
ccatccaaaattctggtgtccctcactctgtctgggctggcactgatgacaacaactatc
aactcccttgtgatcgctgcaattattgtgacccggaagctgcaccatccagccaattat
ttaatttgttcccttgcagtcacagattttcttgtggctgtcctggtgatgcccttcagc
attgtgtatattgtgagagagagctggattatggggcaagtggtctgtgacatttggctg
agtgttgacattacctgctgcacgtgctccatcttgcatctctcagctatagctttggat
cggtatcgagcaatcacagatgctgttgagtatgccaggaaaaggactccaaagcatgct
ggcattatgattacaatagtttggattatatctgtttttatctctatgcctcctctattc
tggaggcaccaaggaactagcagagatgatgaatgcatcatcaagcacgaccacattgtt
tccaccatttactcaacatttggagctttctacatcccactggcattgattttgatcctt
tactacaaaatatatagagcagcaaagacattataccacaagagacaagcaagtaggatt
gcaaaggaggaggtgaatggccaagtccttttggagagtggtgagaaaagcactaaatca
gtttccacatcctatgtactagaaaagtctttatctgacccatcaacagactttgataaa
attcatagcacagtgagaagtctcaggtctgaattcaagcatgagaaatcttggagaagg
caaaagatctcaggtacaagagaacggaaagcagccactaccctgggattaatcttgggt
gcatttgtaatatgttggcttcctttttttgtaaaagaattagttgttaatgtctgtgac
aaatgtaaaatttctgaagaaatgtccaattttttggcatggcttgggtatctcaattcc
cttataaatccactgatttacacaatctttaatgaagacttcaagaaagcattccaaaag
cttgtgcgatgtcgatgttag

DBGET integrated database retrieval system