KEGG   Homo sapiens (human): 3358Help
Entry
3358              CDS       T01001                                 

Gene name
HTR2C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
Definition
5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled
Orthology
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Drug target
Lorcaserin: 
Metergoline: 
Methysergide: 
Pizotifen: 
Dimetotiazine: 
Chlorpromazine: 
Levomepromazine: 
Ziprasidone: 
Lurasidone: 
Clozapine: 
Olanzapine: 
Asenapine: 
Opipramol: 
Mianserin: 
Nefazodone: 
Mirtazapine: 
Agomelatine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq24
AA seq 458 aa AA seqDB search
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctgaggaatgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcatcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgtt
ctgcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaactctgcaaaccct
aaccaagaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgt
tcaggaatcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctcc
aactatttgcgttgcaattataaggtagagaaaaagcctcctgtcaggcagattccaaga
gttgccgccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

DBGET integrated database retrieval system