KEGG   Homo sapiens (human): 3358Help
Entry
3358              CDS       T01001                                 

Gene name
HTR2C, 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Agomelatine: D02578
Amesergide: D02893
Asenapine: D02995
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Clozapine: D00283
Dimetotiazine (DG00843): D01902 D07854
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Idalopirdine (DG01878): D10710
Iloperidone: D02666
Lorcaserin: D06613
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Nefazodone (DG00953): D00819 D08257
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485
Pizotifen (DG00842): D05523 D08397
Ritanserin: D05738
Tedatioxetine (DG01311): D10170 D10171
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Vabicaserin hydrochloride: D06660
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3358 (HTR2C)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3358 (HTR2C)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    3358 (HTR2C)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3358 (HTR2C)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3358 (HTR2C)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3358 (HTR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1385 UPF0182 Pox_P21
Motif
Other DBs
NCBI-GeneID: 3358
NCBI-ProteinID: NP_000859
OMIM: 312861
HGNC: 5295
Ensembl: ENSG00000147246
Vega: OTTHUMG00000022226
Pharos: P28335(Tclin)
UniProt: P28335
Position
Xq23
AA seq 458 aa AA seqDB search
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctgaggaatgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcatcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgtt
ctgcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaactctgcaaaccct
aaccaagaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgt
tcaggaatcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctcc
aactatttgcgttgcaattataaggtagagaaaaagcctcctgtcaggcagattccaaga
gttgccgccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

DBGET integrated database retrieval system