KEGG   Homo sapiens (human): 3358Help
Entry
3358              CDS       T01001                                 

Gene name
HTR2C, 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: 
Agomelatine: 
Amesergide: 
Asenapine: 
Chlorpromazine (DG00867): 
Cinanserin hydrochloride: 
Cinitapride (DG01520): 
Clozapine: 
Dimetotiazine (DG00843): 
Flibanserin: 
Glemanserin: 
Levomepromazine (DG00868): 
Lorcaserin: 
Lurasidone: 
Metergoline: 
Methysergide (DG00835): 
Metrenperone: 
Mianserin (DG00951): 
Mirtazapine: 
Nefazodone (DG00953): 
Olanzapine (DG00898): 
Opipramol (DG00930): 
Pelanserin hydrochloride: 
Pizotifen (DG00842): 
Ritanserin: 
Setiptiline (DG01231): 
Tedatioxetine (DG01311): 
Tropanserin hydrochloride: 
Vabicaserin hydrochloride: 
Ziprasidone (DG00892): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3358 (HTR2C)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3358 (HTR2C)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    3358 (HTR2C)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3358 (HTR2C)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3358 (HTR2C)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3358 (HTR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq24
AA seq 458 aa AA seqDB search
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctgaggaatgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcatcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgtt
ctgcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaactctgcaaaccct
aaccaagaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgt
tcaggaatcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctcc
aactatttgcgttgcaattataaggtagagaaaaagcctcctgtcaggcagattccaaga
gttgccgccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

DBGET integrated database retrieval system