KEGG   Homo sapiens (human): 3359Help
Entry
3359              CDS       T01001                                 

Gene name
HTR3A, 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
Definition
5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
Orthology
K04819  
5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Drug target
Alosetron: 
Cilansetron: 
Metoclopramide: 
Ondansetron: 
Granisetron: 
Tropisetron: 
Dolasetron: 
Palonosetron: 
Metergoline: 
Mirtazapine: 
Vortioxetine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3359 (HTR3A)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   3359 (HTR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.1
AA seq 484 aa AA seqDB search
MLGKLAMLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRD
WRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDS
IWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLT
FTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKF
YVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDT
LPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWL
LCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLA
VCGLLQELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSI
WQYA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaagctcgctatgctgctgtgggtccagcaggcgctgctcgccttgctcctc
cccacactcctggcacagggagaagccaggaggagccgaaacaccaccaggcccgctctg
ctgaggctgtcggattaccttttgaccaactacaggaagggtgtgcgccccgtgagggac
tggaggaagccaaccaccgtatccattgacgtcattgtctatgccatcctcaacgtggat
gagaagaatcaggtgctgaccacctacatctggtaccggcagtactggactgatgagttt
ctccagtggaaccctgaggactttgacaacatcaccaagttgtccatccccacggacagc
atctgggtcccggacattctcatcaatgagttcgtggatgtggggaagtctccaaatatc
ccgtacgtgtatattcggcatcaaggcgaagttcagaactacaagccccttcaggtggtg
actgcctgtagcctcgacatctacaacttccccttcgatgtccagaactgctcgctgacc
ttcaccagttggctgcacaccatccaggacatcaacatctctttgtggcgcttgccagaa
aaggtgaaatccgacaggagtgtcttcatgaaccagggagagtgggagttgctgggggtg
ctgccctactttcgggagttcagcatggaaagcagtaactactatgcagaaatgaagttc
tatgtggtcatccgccggcggcccctcttctatgtggtcagcctgctactgcccagcatc
ttcctcatggtcatggacatcgtgggcttctacctgccccccaacagtggcgagagggtc
tctttcaagattacactcctcctgggctactcggtcttcctgatcatcgtttctgacacg
ctgccggccactgccatcggcactcctctcattggtgtctactttgtggtgtgcatggct
ctgctggtgataagtttggccgagaccatcttcattgtgcggctggtgcacaagcaagac
ctgcagcagcccgtgcctgcttggctgcgtcacctggttctggagagaatcgcctggcta
ctttgcctgagggagcagtcaacttcccagaggcccccagccacctcccaagccaccaag
actgatgactgctcagccatgggaaaccactgcagccacatgggaggaccccaggacttc
gagaagagcccgagggacagatgtagccctcccccaccacctcgggaggcctcgctggcg
gtgtgtgggctgctgcaggagctgtcctccatccggcaattcctggaaaagcgggatgag
atccgagaggtggcccgagactggctgcgcgtgggctccgtgctggacaagctgctattc
cacatttacctgctagcggtgctggcctacagcatcaccctggttatgctctggtccatc
tggcagtacgcttga

DBGET integrated database retrieval system