KEGG   Homo sapiens (human): 3383Help
Entry
3383              CDS       T01001                                 

Gene name
ICAM1, BB2, CD54, P3.58
Definition
intercellular adhesion molecule 1
Orthology
K06490  
intercellular adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Leukocyte transendothelial migration
African trypanosomiasis
Malaria
Staphylococcus aureus infection
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis
Disease
H00083  
Allograft rejection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    3383 (ICAM1)
   04668 TNF signaling pathway
    3383 (ICAM1)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3383 (ICAM1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3383 (ICAM1)
   04670 Leukocyte transendothelial migration
    3383 (ICAM1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3383 (ICAM1)
  Cardiovascular diseases
   05416 Viral myocarditis
    3383 (ICAM1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3383 (ICAM1)
   05166 HTLV-I infection
    3383 (ICAM1)
   05164 Influenza A
    3383 (ICAM1)
   05169 Epstein-Barr virus infection
    3383 (ICAM1)
   05144 Malaria
    3383 (ICAM1)
   05143 African trypanosomiasis
    3383 (ICAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3383 (ICAM1)
Cellular antigens [BR:hsa04090]
 Proteins
  3383 (ICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 532 aa AA seqDB search
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcagcccccggcccgcgctgcccgcactcctggtcctgctcggggctctg
ttcccaggacctggcaatgcccagacatctgtgtccccctcaaaagtcatcctgccccgg
ggaggctccgtgctggtgacatgcagcacctcctgtgaccagcccaagttgttgggcata
gagaccccgttgcctaaaaaggagttgctcctgcctgggaacaaccggaaggtgtatgaa
ctgagcaatgtgcaagaagatagccaaccaatgtgctattcaaactgccctgatgggcag
tcaacagctaaaaccttcctcaccgtgtactggactccagaacgggtggaactggcaccc
ctcccctcttggcagccagtgggcaagaaccttaccctacgctgccaggtggagggtggg
gcaccccgggccaacctcaccgtggtgctgctccgtggggagaaggagctgaaacgggag
ccagctgtgggggagcccgctgaggtcacgaccacggtgctggtgaggagagatcaccat
ggagccaatttctcgtgccgcactgaactggacctgcggccccaagggctggagctgttt
gagaacacctcggccccctaccagctccagacctttgtcctgccagcgactcccccacaa
cttgtcagcccccgggtcctagaggtggacacgcaggggaccgtggtctgttccctggac
gggctgttcccagtctcggaggcccaggtccacctggcactgggggaccagaggttgaac
cccacagtcacctatggcaacgactccttctcggccaaggcctcagtcagtgtgaccgca
gaggacgagggcacccagcggctgacgtgtgcagtaatactggggaaccagagccaggag
acactgcagacagtgaccatctacagctttccggcgcccaacgtgattctgacgaagcca
gaggtctcagaagggaccgaggtgacagtgaagtgtgaggcccaccctagagccaaggtg
acgctgaatggggttccagcccagccactgggcccgagggcccagctcctgctgaaggcc
accccagaggacaacgggcgcagcttctcctgctctgcaaccctggaggtggccggccag
cttatacacaagaaccagacccgggagcttcgtgtcctgtatggcccccgactggacgag
agggattgtccgggaaactggacgtggccagaaaattcccagcagactccaatgtgccag
gcttgggggaacccattgcccgagctcaagtgtctaaaggatggcactttcccactgccc
atcggggaatcagtgactgtcactcgagatcttgagggcacctacctctgtcgggccagg
agcactcaaggggaggtcacccgcaaggtgaccgtgaatgtgctctccccccggtatgag
attgtcatcatcactgtggtagcagccgcagtcataatgggcactgcaggcctcagcacg
tacctctataaccgccagcggaagatcaagaaatacagactacaacaggcccaaaaaggg
acccccatgaaaccgaacacacaagccacgcctccctga

DBGET integrated database retrieval system