KEGG   Homo sapiens (human): 3398Help
Entry
3398              CDS       T01001                                 

Gene name
ID2, GIG8, ID2A, ID2H, bHLHb26
Definition
(RefSeq) inhibitor of DNA binding 2, HLH protein
  KO
K17693  
DNA-binding protein inhibitor ID2
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3398 (ID2)
   04390 Hippo signaling pathway
    3398 (ID2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3398 (ID2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3398 (ID2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3398 (ID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25
AA seq 134 aa AA seqDB search
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg
ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac
gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc
aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac
tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg
acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc
ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga

DBGET integrated database retrieval system