KEGG   Homo sapiens (human): 3422Help
Entry
3422              CDS       T01001                                 

Gene name
IDI1, IPP1, IPPI1
Definition
isopentenyl-diphosphate delta isomerase 1 (EC:5.3.3.2)
Orthology
K01823  
isopentenyl-diphosphate delta-isomerase [EC:5.3.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Module
C5 isoprenoid biosynthesis, mevalonate pathway
C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3422 (IDI1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     3422 (IDI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15.3
AA seq 284 aa AA seqDB search
MWRGLALARAIGCAARGRGQWAVRAADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMMPE
INTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTEN
KLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEV
PPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELL
KKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtggactggcgctggcgcgagcgattggctgcgcggcccgggggcggggccag
tgggcggtgcgcgccgcagactgtgctcaaagcgggcgccatccgggaccggcggttgtc
tgtggccggaggctgatcagtgttctagaacagatcagacattttgtaatgatgcctgaa
ataaacactaaccacctcgacaagcaacaggttcaactcctggcagagatgtgtatcctt
attgatgaaaatgacaataaaattggagctgagaccaagaagaattgtcacctgaacgag
aacattgagaaaggattattgcatcgagcttttagtgtcttcttattcaacaccgaaaat
aagcttctgctacagcaaagatcagatgctaagattacctttccaggttgttttacgaat
acgtgttgtagtcatccattaagcaatccagccgagcttgaggaaagtgacgcccttgga
gtgaggcgagcagcacagagacggctgaaagctgagctaggaattcccttggaagaggtt
cctccagaagaaattaattatttaacacgaattcactacaaagctcagtctgatggtatc
tggggtgaacatgaaattgattacattttgttggtgaggaagaatgtaactttgaatcca
gatcccaatgagattaaaagctattgttatgtgtcaaaggaagaactaaaagaacttctg
aaaaaagcagccagtggtgaaattaagataacgccatggtttaaaattattgcagcgact
tttctctttaaatggtgggataacttaaatcatttgaatcagtttgttgaccatgagaaa
atatacagaatgtga

DBGET integrated database retrieval system