KEGG   Homo sapiens (human): 3423Help
Entry
3423              CDS       T01001                                 

Gene name
IDS, MPS2, SIDS
Definition
iduronate 2-sulfatase (EC:3.1.6.13)
Orthology
K01136  
iduronate 2-sulfatase [EC:3.1.6.13]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Dermatan sulfate degradation
Heparan sulfate degradation
Disease
H00129  
Mucopolysaccharidosis type II (MPS2)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    3423 (IDS)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    3423 (IDS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.13  iduronate-2-sulfatase
     3423 (IDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 550 aa AA seqDB search
MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVR
SPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP
QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHA
NLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK
LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSY
FASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI
FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP
SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQ
GGDLFQLLMP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaccccggaccggccgaggccttctctggctgggtctggttctgagctccgtc
tgcgtcgccctcggatccgaaacgcaggccaactcgaccacagatgctctgaacgttctt
ctcatcatcgtggatgacctgcgcccctccctgggctgttatggggataagctggtgagg
tccccaaatattgaccaactggcatcccacagcctcctcttccagaatgcctttgcgcag
caagcagtgtgcgccccgagccgcgtttctttcctcactggcaggagacctgacaccacc
cgcctgtacgacttcaactcctactggagggtgcacgctggaaacttctccaccatcccc
cagtacttcaaggagaatggctatgtgaccatgtcggtgggaaaagtctttcaccctggg
atatcttctaaccataccgatgattctccgtatagctggtcttttccaccttatcatcct
tcctctgagaagtatgaaaacactaagacatgtcgagggccagatggagaactccatgcc
aacctgctttgccctgtggatgtgctggatgttcccgagggcaccttgcctgacaaacag
agcactgagcaagccatacagttgttggaaaagatgaaaacgtcagccagtcctttcttc
ctggccgttgggtatcataagccacacatccccttcagataccccaaggaatttcagaag
ttgtatcccttggagaacatcaccctggcccccgatcccgaggtccctgatggcctaccc
cctgtggcctacaacccctggatggacatcaggcaacgggaagacgtccaagccttaaac
atcagtgtgccgtatggtccaattcctgtggactttcagcggaaaatccgccagagctac
tttgcctctgtgtcatatttggatacacaggtcggccgcctcttgagtgctttggacgat
cttcagctggccaacagcaccatcattgcatttacctcggatcatgggtgggctctaggt
gaacatggagaatgggccaaatacagcaattttgatgttgctacccatgttcccctgata
ttctatgttcctggaaggacggcttcacttccggaggcaggcgagaagcttttcccttac
ctcgacccttttgattccgcctcacagttgatggagccaggcaggcaatccatggacctt
gtggaacttgtgtctctttttcccacgctggctggacttgcaggactgcaggttccacct
cgctgccccgttccttcatttcacgttgagctgtgcagagaaggcaagaaccttctgaag
cattttcgattccgtgacttggaagaggatccgtacctccctggtaatccccgtgaactg
attgcctatagccagtatccccggccttcagacatccctcagtggaattctgacaagccg
agtttaaaagatataaagatcatgggctattccatacgcaccatagactataggtatact
gtgtgggttggcttcaatcctgatgaatttctagctaacttttctgacatccatgcaggg
gaactgtattttgtggattctgacccattgcaggatcacaatatgtataatgattcccaa
ggtggagatcttttccagttgttgatgccttga

DBGET integrated database retrieval system