KEGG   Homo sapiens (human): 3423Help
Entry
3423              CDS       T01001                                 

Gene name
IDS, MPS2, SIDS
Definition
iduronate 2-sulfatase (EC:3.1.6.13)
Orthology
K01136  
iduronate 2-sulfatase [EC:3.1.6.13]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Dermatan sulfate degradation
Heparan sulfate degradation
Disease
H00129  
Mucopolysaccharidosis type II (MPS2)
H00421  
Mucopolysaccharidosis (MPS)
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 550 aa AA seqDB search
MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVR
SPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP
QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHA
NLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK
LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSY
FASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI
FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP
SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQ
GGDLFQLLMP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaccccggaccggccgaggccttctctggctgggtctggttctgagctccgtc
tgcgtcgccctcggatccgaaacgcaggccaactcgaccacagatgctctgaacgttctt
ctcatcatcgtggatgacctgcgcccctccctgggctgttatggggataagctggtgagg
tccccaaatattgaccaactggcatcccacagcctcctcttccagaatgcctttgcgcag
caagcagtgtgcgccccgagccgcgtttctttcctcactggcaggagacctgacaccacc
cgcctgtacgacttcaactcctactggagggtgcacgctggaaacttctccaccatcccc
cagtacttcaaggagaatggctatgtgaccatgtcggtgggaaaagtctttcaccctggg
atatcttctaaccataccgatgattctccgtatagctggtcttttccaccttatcatcct
tcctctgagaagtatgaaaacactaagacatgtcgagggccagatggagaactccatgcc
aacctgctttgccctgtggatgtgctggatgttcccgagggcaccttgcctgacaaacag
agcactgagcaagccatacagttgttggaaaagatgaaaacgtcagccagtcctttcttc
ctggccgttgggtatcataagccacacatccccttcagataccccaaggaatttcagaag
ttgtatcccttggagaacatcaccctggcccccgatcccgaggtccctgatggcctaccc
cctgtggcctacaacccctggatggacatcaggcaacgggaagacgtccaagccttaaac
atcagtgtgccgtatggtccaattcctgtggactttcagcggaaaatccgccagagctac
tttgcctctgtgtcatatttggatacacaggtcggccgcctcttgagtgctttggacgat
cttcagctggccaacagcaccatcattgcatttacctcggatcatgggtgggctctaggt
gaacatggagaatgggccaaatacagcaattttgatgttgctacccatgttcccctgata
ttctatgttcctggaaggacggcttcacttccggaggcaggcgagaagcttttcccttac
ctcgacccttttgattccgcctcacagttgatggagccaggcaggcaatccatggacctt
gtggaacttgtgtctctttttcccacgctggctggacttgcaggactgcaggttccacct
cgctgccccgttccttcatttcacgttgagctgtgcagagaaggcaagaaccttctgaag
cattttcgattccgtgacttggaagaggatccgtacctccctggtaatccccgtgaactg
attgcctatagccagtatccccggccttcagacatccctcagtggaattctgacaagccg
agtttaaaagatataaagatcatgggctattccatacgcaccatagactataggtatact
gtgtgggttggcttcaatcctgatgaatttctagctaacttttctgacatccatgcaggg
gaactgtattttgtggattctgacccattgcaggatcacaatatgtataatgattcccaa
ggtggagatcttttccagttgttgatgccttga

DBGET integrated database retrieval system